KEGG   Falco peregrinus (peregrine falcon): 101921648Help
Entry
101921648         CDS       T02856                                 

Gene name
TK2
Definition
thymidine kinase 2, mitochondrial
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:fpg00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:fpg00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 168 aa AA seqDB search
MYQDASRWGITLQTYIQLTMLEQHTRPMVSPIRMMERSIHSAKYIFVENLYRSGKMPEVD
YVVLTEWFDWIQSNTDVSVDLIVYLQTSPEVCYERLKRRCREEEKIIPLEYLEAIHQLYE
EWLIKHTLFEVSCPVLVIGADHDMQKMLEKYEENRDQILNPYNMQRHL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaagatgcatcaagatgggggataacgttacagacctacatacagcttaccatg
ctggagcagcataccagaccaatggtttcccccataagaatgatggagcgatcaattcac
agtgcaaaatacatttttgtggaaaatttgtatcgaagcggaaaaatgccagaggtggat
tatgttgtgctgactgagtggtttgactggatccagagcaacactgatgtttctgttgat
ttgatagtttacctgcagacttctcctgaagtttgttatgagaggttaaagagaagatgc
agagaagaggaaaagatcattcctctggaatatttagaagctattcatcagctctacgaa
gagtggcttattaaacatacactgtttgaagtttcctgcccagtgcttgttatcggagct
gaccatgacatgcagaaaatgctagaaaagtatgaagaaaaccgggaccaaatactaaac
ccatataatatgcaacgccatttatag

DBGET integrated database retrieval system