KEGG   Falco peregrinus (peregrine falcon): 101921824Help
Entry
101921824         CDS       T02856                                 

Definition
alanine aminotransferase 2-like
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101921824
   01210 2-Oxocarboxylic acid metabolism
    101921824
   01230 Biosynthesis of amino acids
    101921824
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101921824
Enzymes [BR:fpg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101921824
Amino acid related enzymes [BR:fpg01007]
 Aminotransferase (transaminase)
  Class I
   101921824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 436 aa AA seqDB search
MWGAPWRGGAVEGVPKPFTEVIKANIGDAHAMGQKPITFLRQVTALCLCRRLLAACAGQS
AGAYSASPGIELVRQDVARFLQRRDGVPAKPQDIFLSTGASDAIVSILKLLVSGEGGSRT
GVLIPIPQYPLYSAAIAELSAVQLNYYLDEEHCWALDVAELRRALAEGRRHCCPRVLCII
NPGNPTGQVQSRQCIEDVIKFAFEEKLFLMADEVYQDNIYAEGSAFHSFKKVLFEMGPPY
SEVVELASFHSVSKGFMGECGFRSGYVEVVNMDPDVQQQLAKLVSVRLCPPVPGQILLDT
VVDPPQPGDPSYELFIAEKKAVLSALAHKARLTQEIFNQVPGIRCNPVQGAMYSFPRIEL
PPRALAAAKAQGQAPDMFFCMKLLEETGICVVPGSGFGQREGTFHFRMTILPPTEKLQVL
LEKLSSFYTKFIKEYS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtggggtgccccatggcgagggggcgccgtggaaggtgtccccaagcccttcaccgag
gtgatcaaggcgaacattggtgatgcgcacgccatggggcagaaacccatcaccttcctc
cgccaggtgaccgccctgtgcctgtgccgccggctgctggcagcctgtgccgggcagagc
gctggtgcctacagtgccagccctggtatcgagctggtgcggcaggacgtggcgcgcttc
ctccagcgccgtgatggtgtccccgccaagccccaggacatcttcctctccaccggggcc
agcgatgccatcgtgagcatcctgaagctgctggtgtctggcgagggggggtcccgcacg
ggggtgctgatccccatcccgcagtaccccctctactcggcggccatcgccgagctcagc
gccgtccagctcaactactacctggacgaggagcactgctgggcgctggatgtggccgag
ctgcggcgggcactggccgaggggcgtcggcattgctgcccccgcgtcctctgcatcatc
aaccccggcaaccccactggacaggtacagagccggcagtgcattgaggacgtcatcaag
tttgcctttgaggagaagctcttcctcatggctgatgaggtgtaccaggacaacatctat
gctgagggctcggctttccactccttcaagaaggtgctgtttgagatggggccgccctac
tcggaggtggtggagctggcctccttccactctgtctcaaagggcttcatgggcgagtgc
gggttccgcagtgggtacgtggaggtggtgaacatggaccctgacgtgcagcagcagttg
gccaagctggtgtcagtgcggctgtgcccacctgtgcctgggcagatcctcctggatact
gtcgttgatccaccacagcctggggatccttcatatgagctctttattgctgagaagaag
gcggtgctcagcgccctggcgcacaaggcccggcttacccaggagatcttcaaccaggtg
cccggcatccgctgcaaccctgtgcagggcgccatgtattccttcccccgcatcgagctg
ccgccccgtgccctggccgccgccaaggcgcagggtcaggcccctgacatgttcttctgc
atgaagctgctggaggagacgggcatctgtgtggtgccgggcagcgggtttgggcagcgg
gaaggcaccttccactttcggatgaccatcctgccacccactgagaagctgcaggtcctg
ctggagaagctcagcagcttctacaccaagttcatcaaggagtactcctaa

DBGET integrated database retrieval system