KEGG   Falco peregrinus (peregrine falcon): 101921900Help
Entry
101921900         CDS       T02856                                 

Gene name
BAP1
Definition
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
fpg  Falco peregrinus (peregrine falcon)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 732 aa AA seqDB search
MEVEVRDDGDEEGWGEEGCRSVVKAQSLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGF
IFLFKWIEERRSRRKVSTLVDETSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCNNV
DLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTME
AFHFVSYVPIKGRLFELDGLKVYPIDHGPWADDEEWTDKARRVIMERIGLATAGEPYHDI
RFNLMAVVPDRRMKYESKLHILKMNRQTVLEALQQLIRVTQPELIQTQKSQESQPPEEAK
PASIKTVTPESTHPDGTDEPTSQGHPVATQSPPNKSKPAAKTSASSINGAPPGNPNPIVQ
RLPAFLDNHNYAKSPMQEEEDLAAGVGRSRVPVRQHQQYSDDEDDYDDDDDDEVRNTSSA
IRYKRKGQVKQEHVAGAADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGGTAVA
VVTHSQPSPTPSNESTDTASEIGSAFNSPLRXPIRSANPTRPSSPVTSHISKVLFGEEDG
LLRVDCMRYNRAVRDLGPVISTGLLHLTEDGVFCPLAVADGGKSSPPSIKPGEEAPVAIK
PDEKEGSEASDSKEKVGLGRTSDHPGGEKYSPKELLALLKCVEAEIANYEACLKEEVEKR
KKFKIDDQRRTHNYDEFICTFISMLAQEGMLASLVEQNISVRRRQGVSIGRLHKQRKPDR
RKRSRPYKAKRQ
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggaggttgaggtgcgtgatgatggtgatgaagagggatggggcgaagagggctgcagg
agcgtggtgaaggctcagagtctcttcacactcctggttgaagattttggggtcaaggga
gtgcaggttgaagagatttatgacctgcagagcaaatgccaaggccctgtgtatgggttc
atcttcctgttcaagtggattgaggagcgcagatcacgccgaaaggtctctaccctggtg
gatgagacgtcggtcattgatgatgacatcgttaataacatgttctttgctcaccagctg
atccccaattcctgtgccacccacgccctgctgagtgtcctcctgaactgcaacaatgtc
gacctgggccccacgctgagccgcatgaaggatttcaccaaaggatttagccctgagagc
aaaggctatgccatcggcaatgccccagagctggccaaggcccataacagccatgccagg
ccggagccacgccacttgccagaaaagcagaacggtatcagtgctgtgcgaaccatggag
gcttttcattttgtcagttatgtccctatcaagggacggctgtttgagctggatgggctg
aaggtctatcccattgaccatgggccgtgggctgacgatgaggaatggacggacaaagcc
aggagagtgatcatggagcgcatcggcctggccactgcaggggagccgtaccacgacatc
cgcttcaacctgatggcggtggtgcctgatcggagaatgaagtatgagtctaaactgcac
atcctgaagatgaaccgccagactgtgctggaggccttgcagcagcttatccgagtaact
cagcctgagctgatccagacccagaagtctcaggagtctcagcctcctgaagaggcaaag
ccagccagcataaagactgtgactccggagagcacccacccagacggcaccgacgagccc
accagccagggccaccctgtggccacgcagagcccacccaacaaatccaaaccagcagca
aagacgtcagcgagcagtatcaatggagcacctccaggaaaccccaaccccatcgtgcag
aggttgccagccttcctggataatcacaactatgccaagtcccccatgcaggaagaagaa
gaccttgcagcaggagtgggtcgcagccgggtcccagtccgacagcaccagcagtactca
gatgatgaggatgactatgatgacgatgacgatgatgaagttcgtaacaccagctcggcc
atcaggtacaaaaggaaagggcaggtaaagcaagagcatgtggcgggggctgcggatggc
cagctctccgtcctccagcccaataccatcaatgtcctggctgagaaactgaaggaatct
caaaaggatctttccattcccctgtccatcaagacgagcagcgggggcactgccgtggcg
gtggtcacccactcccagccctctcccacccccagcaacgagagcacggacacggcctcg
gagatcggcagcgccttcaactccccgctgcgnnctcccatccgctcggccaaccccacc
cgcccctccagccccgtcacctcccacatctccaaggtgctctttggcgaggaggacggc
ctgctgcgtgttgactgcatgcgctacaaccgggctgtcagggacttggggcccgttatc
agcaccgggctgctacacctcacggaggacggtgtgttctgcccgctggctgttgcagat
gggggtaaaagctccccgccttccatcaaacccggtgaagaggccccagtcgcaatcaaa
ccggacgagaaggagggcagtgaggccagtgacagcaaagagaaggtgggacttggcagg
accagtgatcaccctgggggggaaaagtattctcccaaggagctgctggcactgctcaag
tgtgtggaggcagagattgcaaactatgaggcgtgcctgaaggaagaggtggagaagagg
aagaaattcaagatcgatgaccagaggagaacccacaactacgatgagttcatatgtacc
ttcatctccatgctggcccaggaaggcatgctggccagcctcgtggagcagaacatctcg
gtccgcaggcggcagggggtcagcatcggccggctgcacaagcagaggaagccagatcgc
cggaaacgctcccgcccgtataaagccaagcgtcagtag

DBGET integrated database retrieval system