KEGG   Falco peregrinus (peregrine falcon): 101922201Help
Entry
101922201         CDS       T02856                                 

Gene name
POR
Definition
P450 (cytochrome) oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
fpg  Falco peregrinus (peregrine falcon)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 674 aa AA seqDB search
MGGAAMEQNISPANSPAQQDSLFSMMDVFLISLITGLFTYWFFFRKKKEEVPDLPKMQSV
AAPVRDSSFIEKMKKTGRNIVVFYGSQTGTAEEFANRLAKDAHRYGLRGMAADPEEYDLS
DLSRLSEIDKSLAVFCMATYGEGDPTDNAQDFYDWLQEADADLSGLRFAVFGLGNKTYEH
FNAMGKYVDKRLEELGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEES
SIRQYELVVHTDVNMNKVYTGEMGRLKSYENQKPPFDAKNPFLAQVTENRKLNEGGERHL
MHLELDISNSKIRYESGDHVAVYPANDSSLVNQIGEILGTDLDTIMSLNNLDEESNKKHP
FPCPTSYRTALMYYLDITNPPRTNVLYELAQYATDAGEQERLRKMASSAAEGKALYLSWV
VEARRNILAILQDMPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNAIHICAVTVEYET
KTGRLNKGVATNWLKNKVPNENGSNSLVPMYVRKSQFRLPFKPSTPVIMIGPGTGIAPFI
GFIQERAWLKQQGKEVGETVGCRREREDYLYREELARFHQEGILTQLNVAFSRDQAEKVY
VQHLLKKNKENIWKLINEGNAHIYVCGDARNMARDVQNTFYEIVAEFGNMGQPQAVDYVK
KLMTKGRYSLDVWS
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggggggtgctgccatggaacaaaacatctcccctgccaacagccctgcgcagcaagac
tcgctcttcagcatgatggacgtgtttctcatctcgctcatcaccgggctttttacgtac
tggttcttcttccgcaagaaaaaagaggaagtcccagacctccccaaaatgcaatcagta
gcagctccagtgagagacagcagcttcattgagaagatgaagaagacggggcgaaacata
gtggttttctacggttcccagacaggtacagcagaggagtttgccaatcgtctcgccaaa
gatgctcatcgctatggcctcaggggcatggcagcggatccagaggagtatgacttgtcg
gacctgagtcgcctctctgagatcgacaagtccttagctgtgttctgcatggccacttac
ggcgagggtgaccccacagacaacgcccaagacttctatgactggctgcaggaggctgat
gctgacctgtcaggtctccgatttgcagtcttcgggctggggaacaagacttatgagcac
ttcaatgccatggggaagtatgtggacaagaggctggaggaacttggagcccagcgcatc
tttgaactcgggctgggagatgacgatggcaacctggaagaagacttcatcacctggagg
gagcagttctggccagcagtgtgtgagcacttcggggtggaggctacaggagaagagtcc
agcatccgccagtatgagctggtggtgcacaccgatgttaacatgaacaaagtctacacc
ggtgagatgggccgcctcaagagctatgagaaccagaagccaccatttgatgccaagaac
cccttcctggcccaggttacagagaaccgcaagctgaatgagggtggagagcgacacctt
atgcacctggagctggatatctccaattccaaaatcaggtatgagtctggggaccatgtg
gcagtgtacccagccaacgactcttctctggtgaatcagatcggtgagatcctgggcacg
gatctggacacgatcatgtccctgaacaatttggatgaggaatccaataagaaacatccc
ttcccctgccccacgtcctaccgtacagccctgatgtactacctggacatcaccaacccg
ccccgcaccaacgtcctctacgagctggcacagtacgccacggacgctggcgagcaggag
cgcctccgcaaaatggcatcgtctgctgccgaggggaaggctctctacctcagctgggtg
gtggaggcccggaggaacatccttgccatcctgcaggacatgccctcgctgcgccccccc
attgatcacttgtgcgagctcctgccccgcctgcaggcccgctactactccattgcctcc
tcgtccaaggttcaccccaacgccatccacatctgtgccgtgacggtggagtacgagacc
aagacgggacgcttgaacaaaggggtggccaccaactggctcaagaacaaggtgcccaac
gagaatgggagcaactccctggtgcccatgtacgtcaggaagtcacagttccgcctgccc
ttcaaacccagcacgcccgtcatcatgatcggaccgggaactggcatagcccccttcatc
ggcttcattcaggagcgggcctggctgaagcagcaaggcaaagaggtgggcgagacggtg
ggctgccgccgtgagcgggaggactacctgtaccgcgaggagctggcccgcttccatcag
gagggaatcctcacccaactcaacgtggccttttccagggaccaggctgagaaggtttat
gttcagcacttactgaagaagaacaaggaaaacatctggaagctgattaatgaggggaat
gctcatatctacgtgtgcggcgatgctcgcaacatggcccgggatgtgcagaacaccttc
tatgagatcgtggccgagttcgggaacatgggccagccccaggccgtggactatgtaaag
aaactgatgacgaagggccggtactctctggatgtctggagctaa

DBGET integrated database retrieval system