KEGG   Falco peregrinus (peregrine falcon): 101923335Help
Entry
101923335         CDS       T02856                                 

Gene name
DBH
Definition
(RefSeq) dopamine beta-hydroxylase
  KO
K00503  dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00350  Tyrosine metabolism
fpg01100  Metabolic pathways
Module
fpg_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    101923335 (DBH)
Enzymes [BR:fpg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     101923335 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu2_monoox_C Cu2_monooxygen DOMON DAO
Motif
Other DBs
NCBI-GeneID: 101923335
NCBI-ProteinID: XP_005231284
Position
Un
AA seq 628 aa AA seqDB search
MGKARRRGAVLPSMQTSRSKPCPCPSFKLREVASMYFTMIAVFLVILVVVLQGSAPRQSD
FPXKVPLDPPGLWNVSYTEQAVHFQLLIKDLQFGLLFGMSDRGEFENADLAVLWSDGHNS
YFGDAWSDATGQIHMDSQQDYQLLGARRAPEGLYLLFRRAFSTCDPKDYIIEDGTVHLIY
GILAKPVHSLQAINISAIHRGLQRVQLLKPNITIPELPSDMKTMEITAPDIVIPSQETTY
WCYMTELPDSFPKHHIIMYEPVITAGNEALVHHMEVFQCAAEFDSFPQYNGPCDSKMKPN
RLNYCRHVLAAWAMGAQAFYYPEEAGLAFGGSGSSRYLRLEIHYHNPMVFKGRHDSSGIR
LYYTATLRRYDAAIMELGLVYTPVMAIPPGEDAFILTGYCTDKCTQMALPTAGIRIFASQ
LHTHLAGRKVVTVLSRNGREQQVVNADGHYSPHFQEIRMLKEVVAVFPGDVLTTTCTYNT
EDRSRATVGGFGILEEMCVNYVHYYPQTQLELCKSAVDLGYLHRYFNLVNSFNDEEVCTC
PQVSVPQQFFSIPWNMFNRDVLKSFYSFAPISMHCNKSSAVQFPGEWEKQPLPKITERLQ
EPVLHCPATPGPQPDTPVPLNLRQLRRD
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagccaggcgcaggggtgccgtcctgcccagcatgcagacctccaggagcaag
ccctgtccctgccccagcttcaagctgcgggaagtggcatccatgtacttcaccatgatc
gctgtgttcctggtcatcttggtggtggtcctgcagggctcggcaccccgccagagtgat
tttccctaaaaagtgcccctcgatccaccggggctgtggaacgtcagctacacggagcaa
gccgtgcatttccagctcctcatcaaggacctgcagtttgggctcctttttgggatgtcg
gacagaggcgagtttgagaatgcagacctggccgtgctctggagcgacgggcacaattcc
tattttggggatgcctggagcgatgccacggggcagatccacatggactcgcagcaggac
taccagctccttggggctcgaagggctcctgaggggctctacctcctcttcagaagagcc
ttcagcacctgtgaccccaaggactacattatagaggatggcaccgtgcaccttatctac
gggatcctggcaaaaccggtccattccctccaagccatcaacatctctgccattcacagg
ggactgcagagggtgcagctgctaaagcccaacatcaccatccctgagctgcccagtgac
atgaagaccatggagataacagcccctgacattgtcattcccagccaggaaacaacctac
tggtgttacatgacagagctgccagacagcttccccaaacatcatattatcatgtatgag
ccagtgatcacggcaggaaacgaggccctggtccaccacatggaagtcttccagtgtgct
gctgagttcgacagcttcccccagtacaacgggccctgcgactccaagatgaagccaaac
cggctcaactactgcaggcacgtgcttgcagcgtgggccatgggagcgcaggctttctac
taccctgaagaagcaggtctggcctttggtggctcaggctcctccagatatttgcgcctt
gagatccactatcacaatcccatggtgttcaaaggtcgccatgactcctcggggatccgc
ctctactacacggccaccctgcgacgctatgatgctgccatcatggagctgggcttggtc
tacacaccagtgatggccattcccccaggcgaggatgccttcatcctcacaggctattgc
accgacaaatgcacgcagatggctctgcccactgccggcatccgcatcttcgcgtcccag
ctccatactcacctggcaggaagaaaagtggtgacagtgctgtcccggaatggaagagaa
cagcaggtcgtgaatgccgacggtcactacagccctcacttccaggagatccgcatgctg
aaggaggtggttgcagtttttccaggtgacgtactcaccaccacctgtacctacaacaca
gaggaccggagccgagccactgtgggtgggtttggcattctggaggagatgtgcgtgaac
tacgtgcactactacccccagacgcagctggagctgtgcaaaagcgcggtggatctgggc
tacctgcaccgatacttcaaccttgtgaacagctttaacgatgaggaggtctgcacgtgc
ccacaggtctccgtcccacagcagtttttctccatcccctggaacatgttcaacagagac
gtgctgaagtccttctacagcttcgctccaatctccatgcactgcaacaaatcctcagct
gtccagttcccgggcgagtgggagaagcagccgcttcccaaaatcaccgagaggctgcag
gagcccgtccttcactgcccggccaccccggggcctcagcctgacacccctgtccccctc
aacctgcgccagctcaggagggactga

DBGET integrated database retrieval system