KEGG   Falco peregrinus (peregrine falcon): 101924103Help
Entry
101924103         CDS       T02856                                 

Gene name
EP300
Definition
(RefSeq) E1A binding protein p300
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Melanogenesis
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101924103 (EP300)
   04330 Notch signaling pathway
    101924103 (EP300)
   04350 TGF-beta signaling pathway
    101924103 (EP300)
   04068 FoxO signaling pathway
    101924103 (EP300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101924103 (EP300)
  Cellular community - eukaryotes
   04520 Adherens junction
    101924103 (EP300)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101924103 (EP300)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    101924103 (EP300)
   05168 Herpes simplex infection
    101924103 (EP300)
Enzymes [BR:fpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101924103 (EP300)
Transcription factors [BR:fpg03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101924103 (EP300)
Chromosome [BR:fpg03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101924103 (EP300)
Mitochondrial biogenesis [BR:fpg03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101924103 (EP300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 2242 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSVSASDGTDFGSLFDLEHDLPDELISSTELGLTNGGD
INQLQTSLGLAQDAASKHKQLSELLRAGSSPNLNMGVGGPGQGMASQTQQNSPGMGMLNS
MVKSPMAQAGLTSPNMSMGASGPNQGPSAQSTAGMMPTVNSPVNQPGMGMNTGMNAGMNP
GMLAAGNGQGMMQGQVMNGSIGAGRGRPNVPYPNPGMGSAGNLLAETLQQGSPQMGGQAG
LRGPQPGAMNKMGMMSNPSPYGQPYSQNTGQQIGASGLGPQMQNKAGLQNSLPQFPMDKK
PVPGAGMANMELVAKKGIAAGANPMGVNGGVGVQAPNLLPDSMLHSTMNSQNPMMSESAS
VASLGAMPTAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVA
YARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMIPNAPGMPQAPMN
QGPNMGQPQPGMSANGPLPDPALIRANVPNQMMNRMQAQPGMNQFGQMNMQLSPMGPRQT
PPLQHPGQLSQAGAMNQMGFPSRMQQPGVGQPSGQNQFLQQTQFPASSPGMNTASMPMTQ
PGNQTPVSQAQMTSASCPVNSPAMAPGSQGSHIHCPPLPQPPIHRNSPSPVPSRTPTPHH
TPPGLGSQQQQAAAAATTAPTPAPQAMPPGPQSQTMHPPQRQTPTPPQAQLPPQVQPPVP
VTPSAEQQQQPLSQQSTTASVPTPTAPLQPQHPTTPLSQPAVSIDGQVSNPPSTSSTEVN
SQQTVPEQQQPPLQEVKIDIKTDEGEPEQTELQMEEKSELKAEPVVEECKPDPMEQEEKK
SEVKTEVSEGEERPATPATQSSPAAGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFR
QPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTS
RVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQN
RYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECIECGRKMHQ
ICVLHNEIIWPSGFVCDGCLKKTGRTRKENKFSAKRLPATRLGTFLENRVNDFLRRQNHP
EAGEVTVRVVHASDKTVEVKPGMKARFVDNGEMAESFPYRTKALFAFEEIDGVDLCFFGM
HVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIW
ACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKSVSERIVHDYKDIFKQATEDRLT
SAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVSKGDSKNAKKKNNKKT
SKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVEPD
PLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHH
VETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQTATTQSPGDSRRLSIQ
RCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHC
QENKCPVPFCLNIKHKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPT
TPTGQQPPTPQTPQPQPPPQPASQPQPAPPNSMPPYTMPRTQPPSAVSQGKAGGQVTPPT
PPQPPQPPVQGPPPAAVEMAMQIQRAAETQRQMAQVQIFQRPIQHQMPQMPPMGMNPPQI
GXXXXIQQQPPWVQGGLPQAQLQPGMQRPSMMSVAQPGQPMNMAPQPGMGQVPGAAQPKQ
PPLPQAALQNLLRTLRSPSSPMQQQQVLNILHSNPQLLAAFIKQRAAKYAGSQNPQGMTG
QPGIPQGQPGLQPQQAMQGQQGGVHPSPAMQNMNPMQAGVQRPSMPQQQPQQQPQQAMAG
MNPQTQQMNMNHSGMAPQFRDLLMRRHQMIEQQRHQQQQQQQGAGPALGAGMANHNQFQQ
PQGVGYPQQQQQRMQHHMQQMQQGNMGQISQLPQAMSAETGASLQQAFQQRLLQQQMGSP
AQPNPMSPQQHMLPNQAQSPHLQGQQLPSSLTNQVRSPQPVPSPRPQSQPPHSSPSPRMQ
PQPSPHHVSPQTSSPHPGLVAAQANPMDQGHFASPDQSAMLSQLASNPGMAGLHGTSATE
LGLSSENSDLNSNLSQSTLDIH
NT seq 6729 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggagccgggcccgccttcagccaagcggcctaaactctcctca
ccggcgctctccgtgtccgccagcgacggcacagattttggatcactttttgatctggaa
catgacttgccagacgaactgataagctccacagaactgggactcaccaatggtggtgac
attaatcagctgcagactagccttggcctggcacaggatgctgcctctaaacataagcag
ctgtctgaacttctacgggctggtagttccccaaatctcaatatgggggttggtggccct
ggccaaggcatggccagtcaaacccaacaaaatagtcctggaatgggaatgttaaacagc
atggtgaaaagccccatggcacaggctggtttgacttctcccaatatgtcaatgggtgca
agtggaccaaaccagggtccttcagcccaatccacagccggaatgatgccaacagtaaac
agtccagttaaccagcctggcatgggaatgaacacagggatgaatgctggcatgaatcct
gggatgttggcagcaggcaatggacaggggatgatgcaggggcaagtcatgaacggttca
attggagcaggcagagggcgacctaatgtgccatacccaaacccaggaatgggtagtgct
ggtaacttgttggctgagacactgcaacaaggctctccacagatgggaggacaggctgga
ctgagagggccacagcctggagcaatgaacaagatgggaatgatgagcaaccctagccct
tatggccagccatatagtcagaatactgggcagcagattggagccagtggacttgggcct
cagatgcaaaataaagctggactgcagaatagcttaccacagtttccaatggacaagaag
ccagttcctggggcaggaatggctaacatggagctggtggctaagaagggaattgcagca
ggtgcaaatccaatgggtgtgaatggaggagtaggggttcaagcccctaatctgctgcct
gactcaatgttgcattcaacaatgaattctcaaaaccccatgatgagtgaaagtgccagc
gttgccagtttgggagccatgccaacagctcaaccatccaatactggaattcgaaagcag
tggcatgaagacattactcaggatcttcgaaaccaccttgttcataaattagtccaagcc
atatttccgactcctgaccctgcagcactgaaggatcggcgtatggagaatctggtggca
tatgctcggaaagtggagggggatatgtatgaatcggcaaatagcagggcagagtactat
cacttgctagcagagaagatctataagattcagaaggagttggaggagaaacgaagaacc
aggctgcagaagcaaaacatgatcccaaatgctccgggcatgccacaggctcccatgaac
caagggcccaacatgggacagccccagccagggatgtctgcaaatggtcctcttcctgat
ccagccctaatacgtgccaatgtgccaaaccagatgatgaatcgcatgcaggcacagcca
ggaatgaatcagtttggccagatgaacatgcagctgtcaccgatgggaccccggcaaacc
cctcctcttcagcaccctggacagctaagccaggctggggccatgaaccagatggggttt
ccttcacgtatgcagcagccaggagttggccagccttctggtcagaaccagtttctacaa
cagacccagttccctgcttcttcaccgggaatgaacacagcaagcatgcctatgactcag
cctggcaatcagacaccagtttctcaagcacaaatgaccagcgcttcctgtcctgtgaat
tctcctgcaatggctccaggttctcaagggagccatattcactgcccacctcttccacag
cctcccatacaccgaaattctccttccccagtacctagtcgaaccccaacacctcaccac
acacccccaggcttgggatcacagcaacagcaggcagcagcagctgccactactgccccc
acacctgctcctcaggcaatgccacctggaccacagtcgcaaactatgcacccccctcaa
aggcaaactccaacacctccgcaggcacagctgcctccacaggtccagcctccggttcca
gttaccccttctgcagagcaacagcagcaacctttgtcacagcagagcacgactgcatct
gttcctacaccaacagcaccgctgcagcctcagcaccccacaacacctctttcacagcca
gctgtaagtattgatgggcaggtatccaatcccccatccacaagcagcacagaggtgaac
tctcagcagactgttccagagcagcagcagccacccttgcaggaagtgaaaattgatatt
aaaacagatgaaggggaaccagaacaaacagagctgcaaatggaggagaaatctgagctt
aaagcagaaccagttgtggaggagtgtaaaccagacccaatggagcaagaagagaagaaa
tctgaagtgaagactgaagtatcggagggggaagaaagacctgctactccagctactcag
tcttctccggcagctgggcagtctaagaaaaaaattttcaagccagaggagttacggcag
gcgcttatgccaacactggaggcactttaccgtcaggatccagagtctcttccatttcga
cagcctgtagatccccagctactaggaattcctgattattttgacatagtgaagaacccc
atggacctctctactatcaagaggaagctagacacaggacagtatcaggaaccgtggcaa
tatgtagatgacatctggctcatgttcaataatgcctggttgtataaccgcaaaacatcc
cgggtatataagtactgttccaaactggcagaggtgtttgagcaagaaattgacccagtt
atgcagagccttggttattgctgtggaagaaagttggagttctcaccacagactttgtgt
tgctatgggaaacagctatgcacaattcctcgagatgccacttactacagttaccagaac
aggtatcatttctgtgagaagtgcttcaacgaaatccaaggggagagtgtttctctggga
gacgacccatcacaacctcagaccacgataaacaaagaacagttttcaaaaaggaaaaat
gacacactggaccctgaactatttgttgaatgtatagagtgtggaagaaaaatgcaccag
atctgtgttcttcacaatgaaataatctggccttctggctttgtctgtgatggctgccta
aagaaaacaggacgcaccaggaaagagaataaattctctgctaaaaggttaccagctaca
agacttggtaccttcttggagaatagagtcaatgatttcctaagacgacagaatcaccct
gaggcaggagaggttacagttagggtggtacatgcatctgacaaaactgttgaagtaaag
ccaggaatgaaagcaaggtttgtagacaacggagagatggctgagtctttcccttatcga
acaaaagcgctttttgcctttgaggaaattgatggtgtagacttgtgcttctttgggatg
catgtacaggagtatggctcagactgtcctccacccaatcaaaggcgagtgtatatatct
taccttgacagtgttcatttctttcgccctaaatgcttgaggactgctgtctatcatgaa
atactaattggatatctagaatatgtcaagaaactagggtatactactggacatatctgg
gcatgcccaccgagtgaaggagatgactacatcttccactgccatcctcctgaccaaaag
atacccaaacccaagcgactgcaagagtggtacaaaaagatgctggacaagtctgtgtcg
gagcgcattgtccatgattacaaggatatatttaagcaggcgacagaagatcgtctaaca
agtgcaaaagagctaccttacttcgaaggggatttctggccgaacgttctagaggagagc
attaaagaactagagcaagaggaagaagaacgaaagagagaagaaaacactagtaatgaa
agcacggatgtgagcaagggagacagcaaaaatgccaaaaagaagaacaataagaagaca
agtaagaacaagagcagcttgagtcgtggcaataagaaaaagcctggcatgcccaatgtg
tccaatgacctctcccaaaagctgtatgccactatggagaagcacaaggaggtcttcttt
gtcatccgtctcattgctggccctgcagccaactccctgccccccatcgttgagcctgac
ccgctcattccatgtgacctgatggatggacgtgatgctttcctaacacttgctagagac
aagcacctggagttctcctcactacgaagggctcagtggtcaaccatgtgcatgttggtg
gaactgcatacccagagccaagaccgctttgtttacacctgcaatgagtgcaagcatcac
gtggagaccagatggcactgcactgtttgtgaggattatgacctgtgcatcacctgctat
aacactaaaaaccatgaccacaagatggaaaaattaggccttggtctagacgatgagagc
aacaaccagcagactgcaaccactcagagccccggtgattcccgccgcctgagcattcag
cgctgtatccagtctctggtccatgcctgccagtgtcgtaatgccaactgctcactgcca
tcctgtcagaagatgaaacgggttgtccaacacaccaaaggctgcaaacgcaaaaccaac
ggagggtgccccatctgcaagcaactcattgcgctctgctgctaccatgcaaagcactgc
caggagaacaagtgccccgtgcccttctgcctcaacattaaacacaagctccgtcaacaa
cagcttcagcaccgcctgcaacaggcgcagatgctccgaaggaggatggcaagtatgcag
cggactggtgtggtgggccagcagcaaggattgccctcgcccacaccagccactccaaca
actccaacaggccagcagcccccaacaccacaaaccccgcaaccccagcctccaccccag
cctgcctcgcagcctcaacctgcacctcccaacagtatgccaccctacaccatgccgaga
actcagccccccagcgctgtgtcccaaggcaaggcaggtggccaggtgactcctccaaca
ccaccccagccacctcaaccaccggttcagggtcctcctccagcagcagtggaaatggcc
atgcagatccagcgggcagcagagacccagcgtcagatggcacaggttcagatcttccaa
aggccgattcagcaccagatgccccagatgccacctatgggaatgaaccctccacaaatc
ggcnnnnnnnnnngaatccagcagcagccaccgtgggtgcaggggggcttaccccaagct
cagctgcagccgggaatgcagaggccatccatgatgtcagtagcccagccaggtcagccg
atgaatatggcacctcagccagggatgggtcaggtacctggtgctgctcagcccaagcaa
ccacctctgccccaggcagccttacaaaacctgctgcggactctcaggtctcccagctca
cccatgcagcagcaacaggtgcttaacatccttcactccaatcctcagctgctggccgct
ttcatcaagcagcgggctgccaagtacgcggggtcccagaacccccagggcatgacgggt
cagcctggcatccctcagggtcagccaggtctccagccacagcaggccatgcaagggcag
cagggaggggtgcatcccagcccagccatgcagaacatgaaccccatgcaagcaggagtg
cagaggcccagcatgccacagcagcagccgcagcagcagccgcagcaggccatggctggg
atgaatcctcagacgcagcagatgaatatgaatcactcggggatggctccccagttccga
gacctcctgatgaggcgacaccagatgattgaacagcagcgccaccagcagcagcagcag
cagcagggagcaggaccagcactgggggcggggatggccaaccacaaccagtttcagcag
ccccagggcgtcgggtatccccagcagcagcagcagcgaatgcagcatcacatgcagcag
atgcagcaaggaaacatgggacaaataagccagcttccacaggcgatgagtgcagagaca
ggagccagtttgcagcaggctttccagcagaggctacttcagcagcagatggggtcccca
gctcagcccaaccctatgagcccccagcagcacatgctccccaatcaggcccagtccccg
cacctacagggccagcagctcccttcatcgctcaccaatcaagtgcgatctccgcagcct
gtaccctcaccgcggccccagtcccagcccccccattccagcccgtcccctcggatgcaa
cctcagccttctccgcaccacgtctccccgcagaccagctccccacatccaggactggta
gccgcccaggctaaccccatggatcaagggcactttgccagcccggaccagagtgcaatg
ctttcccagcttgctagcaatcctggcatggcaggcctccatggtacaagcgccacggaa
ctggggctcagctctgagaactcagacttgaattcaaacctttcacagagtacactagac
atacactag

DBGET integrated database retrieval system