KEGG   Falco peregrinus (peregrine falcon): 101924103Help
Entry
101924103         CDS       T02856                                 

Gene name
EP300
Definition
E1A binding protein p300
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101924103 (EP300)
   04330 Notch signaling pathway
    101924103 (EP300)
   04350 TGF-beta signaling pathway
    101924103 (EP300)
   04630 Jak-STAT signaling pathway
    101924103 (EP300)
   04068 FoxO signaling pathway
    101924103 (EP300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101924103 (EP300)
  Cellular commiunity
   04520 Adherens junction
    101924103 (EP300)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101924103 (EP300)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    101924103 (EP300)
   05168 Herpes simplex infection
    101924103 (EP300)
Enzymes [BR:fpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101924103 (EP300)
Transcription factors [BR:fpg03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101924103 (EP300)
Mitochondrial biogenesis [BR:fpg03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101924103 (EP300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2247 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSVSASDGTDFGSLFDLEHDLPDELISSTELGLTNGGD
INQLQTSLGLAQDAASKHKQLSELLRAGSSPNLNMGVGGPGQGMASQTQQNSPGMGMLNS
MVKSPMAQAGLTSPNMSMGASGPNQGPSAQSTAGMMPTVNSPVNQPGMGMNTGMNAGMNP
GMLAAGNGQGMMQGQVMNGSIGAGRGRPNVPYPNPGMGSAGNLLAETLQQGSPQMGGQAG
LRGPQPGAMNKMGMMSNPSPYGQPYSQNTGQQIGASGLGPQMQNKAGLQNSLPQFPMDKK
PVPGAGMANMELVAKKGIAAGANPMGVNGGVGVQAPNLLPDSMLHSTMNSQNPMMSESAS
VASLGAMPTAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVA
YARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMIPNAPGMPQAPMN
QGPNMGQPQPGMSANGPLPDPALIRANVPNQMMNRMQAQPGMNQFGQMNMQLSPMGPRQT
PPLQHPGQLSQAGAMNQVSVPFMGFPSRMQQPGVGQPSGQNQFLQQTQFPASSPGMNTAS
MPMTQPGNQTPVSQAQMTSASCPVNSPAMAPGSQGSHIHCPPLPQPPIHRNSPSPVPSRT
PTPHHTPPGLGSQQQQAAAAATTAPTPAPQAMPPGPQSQTMHPPQRQTPTPPQAQLPPQV
QPPVPVTPSAEQQQQPLSQQSTTASVPTPTAPLQPQHPTTPLSQPAVSIDGQVSNPPSTS
STEVNSQQTVPEQQQPPLQEVKIDIKTDEGEPEQTELQMEEKSELKAEPVVEECKPDPME
QEEKKSEVKTEVSEGEERPATPATQSSPAAGQSKKKIFKPEELRQALMPTLEALYRQDPE
SLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLY
NRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATY
YSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECIECG
RKMHQICVLHNEIIWPSGFVCDGCLKKTGRTRKENKFSAKRLPATRLGTFLENRVNDFLR
RQNHPEAGEVTVRVVHASDKTVEVKPGMKARFVDNGEMAESFPYRTKALFAFEEIDGVDL
CFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYT
TGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKSVSERIVHDYKDIFKQAT
EDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVSKGDSKNAKKK
NNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPP
IVEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCN
ECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQTATTQSPGDSR
RLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCY
HAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPT
PATPTTPTGQQPPTPQTPQPQPPPQPASQPQPAPPNSMPPYTMPRTQPPSAVSQGKAGGQ
VTPPTPPQPPQPPVQGPPPAAVEMAMQIQRAAETQRQMAQVQIFQRPIQHQMPQMPPMGM
NPPQIGXXXXIQQQPPWVQGGLPQAQLQPGMQRPSMMSVAQPGQPMNMAPQPGMGQVPGA
AQPKQPPLPQAALQNLLRTLRSPSSPMQQQQVLNILHSNPQLLAAFIKQRAAKYAGSQNP
QGMTGQPGIPQGQPGLQPQQAMQGQQGGVHPSPAMQNMNPMQAGVQRPSMPQQQPQQQPQ
QAMAGMNPQTQQMNMNHSGMAPQFRDLLMRRHQMIEQQRHQQQQQQQGAGPALGAGMANH
NQFQQPQGVGYPQQQQQRMQHHMQQMQQGNMGQISQLPQAMSAETGASLQQAFQQRLLQQ
QMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQLPSSLTNQVRSPQPVPSPRPQSQPPHSSP
SPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMDQGHFASPDQSAMLSQLASNPGMAGLHG
TSATELGLSSENSDLNSNLSQSTLDIH
NT seq 6744 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggagccgggcccgccttcagccaagcggcctaaactctcctca
ccggcgctctccgtgtccgccagcgacggcacagattttggatcactttttgatctggaa
catgacttgccagacgaactgataagctccacagaactgggactcaccaatggtggtgac
attaatcagctgcagactagccttggcctggcacaggatgctgcctctaaacataagcag
ctgtctgaacttctacgggctggtagttccccaaatctcaatatgggggttggtggccct
ggccaaggcatggccagtcaaacccaacaaaatagtcctggaatgggaatgttaaacagc
atggtgaaaagccccatggcacaggctggtttgacttctcccaatatgtcaatgggtgca
agtggaccaaaccagggtccttcagcccaatccacagccggaatgatgccaacagtaaac
agtccagttaaccagcctggcatgggaatgaacacagggatgaatgctggcatgaatcct
gggatgttggcagcaggcaatggacaggggatgatgcaggggcaagtcatgaacggttca
attggagcaggcagagggcgacctaatgtgccatacccaaacccaggaatgggtagtgct
ggtaacttgttggctgagacactgcaacaaggctctccacagatgggaggacaggctgga
ctgagagggccacagcctggagcaatgaacaagatgggaatgatgagcaaccctagccct
tatggccagccatatagtcagaatactgggcagcagattggagccagtggacttgggcct
cagatgcaaaataaagctggactgcagaatagcttaccacagtttccaatggacaagaag
ccagttcctggggcaggaatggctaacatggagctggtggctaagaagggaattgcagca
ggtgcaaatccaatgggtgtgaatggaggagtaggggttcaagcccctaatctgctgcct
gactcaatgttgcattcaacaatgaattctcaaaaccccatgatgagtgaaagtgccagc
gttgccagtttgggagccatgccaacagctcaaccatccaatactggaattcgaaagcag
tggcatgaagacattactcaggatcttcgaaaccaccttgttcataaattagtccaagcc
atatttccgactcctgaccctgcagcactgaaggatcggcgtatggagaatctggtggca
tatgctcggaaagtggagggggatatgtatgaatcggcaaatagcagggcagagtactat
cacttgctagcagagaagatctataagattcagaaggagttggaggagaaacgaagaacc
aggctgcagaagcaaaacatgatcccaaatgctccgggcatgccacaggctcccatgaac
caagggcccaacatgggacagccccagccagggatgtctgcaaatggtcctcttcctgat
ccagccctaatacgtgccaatgtgccaaaccagatgatgaatcgcatgcaggcacagcca
ggaatgaatcagtttggccagatgaacatgcagctgtcaccgatgggaccccggcaaacc
cctcctcttcagcaccctggacagctaagccaggctggggccatgaaccaggtcagtgtg
ccttttatggggtttccttcacgtatgcagcagccaggagttggccagccttctggtcag
aaccagtttctacaacagacccagttccctgcttcttcaccgggaatgaacacagcaagc
atgcctatgactcagcctggcaatcagacaccagtttctcaagcacaaatgaccagcgct
tcctgtcctgtgaattctcctgcaatggctccaggttctcaagggagccatattcactgc
ccacctcttccacagcctcccatacaccgaaattctccttccccagtacctagtcgaacc
ccaacacctcaccacacacccccaggcttgggatcacagcaacagcaggcagcagcagct
gccactactgcccccacacctgctcctcaggcaatgccacctggaccacagtcgcaaact
atgcacccccctcaaaggcaaactccaacacctccgcaggcacagctgcctccacaggtc
cagcctccggttccagttaccccttctgcagagcaacagcagcaacctttgtcacagcag
agcacgactgcatctgttcctacaccaacagcaccgctgcagcctcagcaccccacaaca
cctctttcacagccagctgtaagtattgatgggcaggtatccaatcccccatccacaagc
agcacagaggtgaactctcagcagactgttccagagcagcagcagccacccttgcaggaa
gtgaaaattgatattaaaacagatgaaggggaaccagaacaaacagagctgcaaatggag
gagaaatctgagcttaaagcagaaccagttgtggaggagtgtaaaccagacccaatggag
caagaagagaagaaatctgaagtgaagactgaagtatcggagggggaagaaagacctgct
actccagctactcagtcttctccggcagctgggcagtctaagaaaaaaattttcaagcca
gaggagttacggcaggcgcttatgccaacactggaggcactttaccgtcaggatccagag
tctcttccatttcgacagcctgtagatccccagctactaggaattcctgattattttgac
atagtgaagaaccccatggacctctctactatcaagaggaagctagacacaggacagtat
caggaaccgtggcaatatgtagatgacatctggctcatgttcaataatgcctggttgtat
aaccgcaaaacatcccgggtatataagtactgttccaaactggcagaggtgtttgagcaa
gaaattgacccagttatgcagagccttggttattgctgtggaagaaagttggagttctca
ccacagactttgtgttgctatgggaaacagctatgcacaattcctcgagatgccacttac
tacagttaccagaacaggtatcatttctgtgagaagtgcttcaacgaaatccaaggggag
agtgtttctctgggagacgacccatcacaacctcagaccacgataaacaaagaacagttt
tcaaaaaggaaaaatgacacactggaccctgaactatttgttgaatgtatagagtgtgga
agaaaaatgcaccagatctgtgttcttcacaatgaaataatctggccttctggctttgtc
tgtgatggctgcctaaagaaaacaggacgcaccaggaaagagaataaattctctgctaaa
aggttaccagctacaagacttggtaccttcttggagaatagagtcaatgatttcctaaga
cgacagaatcaccctgaggcaggagaggttacagttagggtggtacatgcatctgacaaa
actgttgaagtaaagccaggaatgaaagcaaggtttgtagacaacggagagatggctgag
tctttcccttatcgaacaaaagcgctttttgcctttgaggaaattgatggtgtagacttg
tgcttctttgggatgcatgtacaggagtatggctcagactgtcctccacccaatcaaagg
cgagtgtatatatcttaccttgacagtgttcatttctttcgccctaaatgcttgaggact
gctgtctatcatgaaatactaattggatatctagaatatgtcaagaaactagggtatact
actggacatatctgggcatgcccaccgagtgaaggagatgactacatcttccactgccat
cctcctgaccaaaagatacccaaacccaagcgactgcaagagtggtacaaaaagatgctg
gacaagtctgtgtcggagcgcattgtccatgattacaaggatatatttaagcaggcgaca
gaagatcgtctaacaagtgcaaaagagctaccttacttcgaaggggatttctggccgaac
gttctagaggagagcattaaagaactagagcaagaggaagaagaacgaaagagagaagaa
aacactagtaatgaaagcacggatgtgagcaagggagacagcaaaaatgccaaaaagaag
aacaataagaagacaagtaagaacaagagcagcttgagtcgtggcaataagaaaaagcct
ggcatgcccaatgtgtccaatgacctctcccaaaagctgtatgccactatggagaagcac
aaggaggtcttctttgtcatccgtctcattgctggccctgcagccaactccctgcccccc
atcgttgagcctgacccgctcattccatgtgacctgatggatggacgtgatgctttccta
acacttgctagagacaagcacctggagttctcctcactacgaagggctcagtggtcaacc
atgtgcatgttggtggaactgcatacccagagccaagaccgctttgtttacacctgcaat
gagtgcaagcatcacgtggagaccagatggcactgcactgtttgtgaggattatgacctg
tgcatcacctgctataacactaaaaaccatgaccacaagatggaaaaattaggccttggt
ctagacgatgagagcaacaaccagcagactgcaaccactcagagccccggtgattcccgc
cgcctgagcattcagcgctgtatccagtctctggtccatgcctgccagtgtcgtaatgcc
aactgctcactgccatcctgtcagaagatgaaacgggttgtccaacacaccaaaggctgc
aaacgcaaaaccaacggagggtgccccatctgcaagcaactcattgcgctctgctgctac
catgcaaagcactgccaggagaacaagtgccccgtgcccttctgcctcaacattaaacac
aagctccgtcaacaacagcttcagcaccgcctgcaacaggcgcagatgctccgaaggagg
atggcaagtatgcagcggactggtgtggtgggccagcagcaaggattgccctcgcccaca
ccagccactccaacaactccaacaggccagcagcccccaacaccacaaaccccgcaaccc
cagcctccaccccagcctgcctcgcagcctcaacctgcacctcccaacagtatgccaccc
tacaccatgccgagaactcagccccccagcgctgtgtcccaaggcaaggcaggtggccag
gtgactcctccaacaccaccccagccacctcaaccaccggttcagggtcctcctccagca
gcagtggaaatggccatgcagatccagcgggcagcagagacccagcgtcagatggcacag
gttcagatcttccaaaggccgattcagcaccagatgccccagatgccacctatgggaatg
aaccctccacaaatcggcnnnnnnnnnngaatccagcagcagccaccgtgggtgcagggg
ggcttaccccaagctcagctgcagccgggaatgcagaggccatccatgatgtcagtagcc
cagccaggtcagccgatgaatatggcacctcagccagggatgggtcaggtacctggtgct
gctcagcccaagcaaccacctctgccccaggcagccttacaaaacctgctgcggactctc
aggtctcccagctcacccatgcagcagcaacaggtgcttaacatccttcactccaatcct
cagctgctggccgctttcatcaagcagcgggctgccaagtacgcggggtcccagaacccc
cagggcatgacgggtcagcctggcatccctcagggtcagccaggtctccagccacagcag
gccatgcaagggcagcagggaggggtgcatcccagcccagccatgcagaacatgaacccc
atgcaagcaggagtgcagaggcccagcatgccacagcagcagccgcagcagcagccgcag
caggccatggctgggatgaatcctcagacgcagcagatgaatatgaatcactcggggatg
gctccccagttccgagacctcctgatgaggcgacaccagatgattgaacagcagcgccac
cagcagcagcagcagcagcagggagcaggaccagcactgggggcggggatggccaaccac
aaccagtttcagcagccccagggcgtcgggtatccccagcagcagcagcagcgaatgcag
catcacatgcagcagatgcagcaaggaaacatgggacaaataagccagcttccacaggcg
atgagtgcagagacaggagccagtttgcagcaggctttccagcagaggctacttcagcag
cagatggggtccccagctcagcccaaccctatgagcccccagcagcacatgctccccaat
caggcccagtccccgcacctacagggccagcagctcccttcatcgctcaccaatcaagtg
cgatctccgcagcctgtaccctcaccgcggccccagtcccagcccccccattccagcccg
tcccctcggatgcaacctcagccttctccgcaccacgtctccccgcagaccagctcccca
catccaggactggtagccgcccaggctaaccccatggatcaagggcactttgccagcccg
gaccagagtgcaatgctttcccagcttgctagcaatcctggcatggcaggcctccatggt
acaagcgccacggaactggggctcagctctgagaactcagacttgaattcaaacctttca
cagagtacactagacatacactag

DBGET integrated database retrieval system