KEGG   Falco peregrinus (peregrine falcon): 101924110Help
Entry
101924110         CDS       T02856                                 

Gene name
GBE1
Definition
(RefSeq) 1,4-alpha-glucan branching enzyme 1
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101924110 (GBE1)
Enzymes [BR:fpg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     101924110 (GBE1)
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101924110 (GBE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 914 aa AA seqDB search
MVQVDGQKCVSVFAVVYPETCSNLTVFKGNSASDIVVLGHSVTVCLMYSLFYNRLKNIEE
SEGGLDKFSKSYKTFGVNQFVDGGIYCKEWAPGAEAVFLAGDFNGWNPFSHPYKKMEYGK
WELFIPPGQDGYPPVAHGSKLKVVIRAQNGELLYRISPWARYVVRDEDKVNYDWVHWNPP
ESYIHKHPSPKRLKSLRIYESHVGIASPEGKVASYKNFTYNVLPRIKDLGYNCVQLMAIM
EHAYYASFGYQVTSFFAASSRYGTPDDLKEMIDVAHSMGITVLLDVVHSHASKNSEDGLN
KFDGTDSCFFHSGPKGTHQLWDSRLFDYANWEVLRFLLSNLRMWIEDYRFDGFRFDGVTS
MLYHHHGIGTGFSGDYNEYFGLQVDEDALCYLMLANHMIKFLHPECITIAEDVSGMPALC
RPVAEGGGGFDYRLAMAIPDKWIQIIKELKDEDWNMGNIVHTLTNRRYEEKYIAYAESHD
QALVGDKTLAFRLMDAEMYTNMSVLSPLTAVIDRGIQLHKMIRLITHALGGESYLNFMGN
EFGHPEWLDFPRKGNNESYHYARRQFNLTEDHLLRYRFLNAFDRDMNKLEERFGWLASPP
AFVSEKHESNKVIAFERAGLIFIFNFHPYQSYVDYRVGIETPGKYPFNCCLFYKILLDSD
AAEYGGHQRLDHSTEYFSEEYPHNYRPNSLMQSNSQTTFSQHPRRCPKHHIEFLLYHKHE
QNTIVVTDTPPLSKTSYPQDTQPPELEVWDEEQNVLTVQEEMVSDLLLHLDTHKSTGPDG
IHTRKALGGGVSKHCMWLLRFREQLEVDEFGMAVLKSAINTRDLKRVPWGGLDTVNQLAC
HSGPGEESSAGNSLCVVFENIGCSFGIIIYAQSGNKEKPQRSNYYIVVNSSFVYYVCFDF
STPSRPGYTVFALF
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggtggatgggcaaaaatgtgtaagtgtttttgctgtagtgtatcctgagaca
tgttcaaatcttactgtctttaaagggaacagcgcatctgatattgtagtcttaggacat
agtgtgacagtgtgtctcatgtattctctgttttataaccgcttgaagaacattgaagaa
agtgaaggcggccttgataaattttcaaaaagttacaaaacctttggagttaatcagttt
gtggatggcggaatatattgcaaagagtgggcaccaggagcagaagcagtgtttctcgca
ggtgacttcaatggctggaatccattttctcatccatataagaagatggaatatgggaag
tgggagttgttcatcccacctggacaagatggttatcctcctgtggcccacggatcaaag
ctaaaggtggtgatccgtgctcaaaatggcgaactcctctatcgtatttcaccttgggca
agatatgtagtccgtgatgaagacaaagtgaattacgattgggtacactggaatccacca
gagtcatatatacataagcatccttcccccaagagattaaaaagcctaagaatctatgaa
tctcatgtggggattgcttccccagaagggaaagtagcttcttacaaaaacttcacatac
aatgtactacctagaataaaggatcttggatataactgtgtccagctgatggctattatg
gaacatgcatactatgccagttttggttatcaggtcacaagcttctttgcagcatcaagc
cgttatggaactccagacgacctgaaagaaatgattgacgttgctcactcaatgggcatc
actgtcctgctggacgttgtgcacagccatgcatcaaaaaactctgaagacggtctcaac
aaatttgatggtacagattcttgtttcttccattctggtcctaaaggaactcatcagctc
tgggacagcaggctctttgactatgcaaactgggaagttttgagattccttctgtctaat
ttgagaatgtggattgaagactatcgctttgatggattccggtttgatggtgttacatct
atgttgtatcaccatcatgggattggcacaggattcagtggagattacaatgaatatttt
ggcctacaagtggatgaagatgctttgtgttatctcatgctggccaaccacatgattaaa
ttcttgcatccagaatgcataaccatagcggaggatgtttctggaatgccagctctttgt
cgtcccgttgcagagggaggagggggtttcgattatcgactagccatggctattccagat
aaatggatacagattattaaggagctgaaagatgaagactggaatatgggcaatattgtg
catacattaacaaacagacggtatgaagaaaaatacattgcatatgcagagagtcatgac
caggcgcttgttggtgataagaccttggcgtttcgactgatggatgcagaaatgtataca
aacatgagtgtgctctcacctcttactgcagttattgatcgtggaatacagcttcataaa
atgattcgtctcattactcatgcacttggaggagagagctatctgaacttcatgggcaac
gaatttggacatccagaatggcttgacttccccagaaaaggaaataatgagagctaccac
tatgccagaagacagtttaatcttactgaggatcatcttctccgctatagattcctaaac
gcatttgatagagatatgaataaattggaggaaagatttggctggcttgcatctcccccg
gcctttgtgagtgaaaagcatgaatccaataaggtcatagcatttgagagagcaggtctc
atttttattttcaacttccatccatatcaaagttatgtggactacagagtgggtattgaa
actccaggaaaatatccttttaattgctgtttgttttataaaatccttctggattctgat
gctgcagaatatggaggacatcaaaggctggaccacagtacagaatacttctctgaagaa
tatcctcacaattatcgacctaattcacttatgcaatccaattcacagaccaccttcagc
caacaccccagaagatgccccaagcaccacatagagtttctcctctaccacaaacatgaa
caaaatactattgtagtgacagatacacctcccttaagcaagaccagttaccctcaggat
actcagcctcctgagctggaagtctgggatgaggagcaaaatgtcctcacagtccaggag
gaaatggtcagtgacctgcttctgcacttggacacgcacaagtctacggggccagatggg
atccacacgaggaaggctcttggtggtggagtatccaagcattgcatgtggctcttgcgc
ttccgtgagcagttagaggttgacgagttcggcatggcagttttgaaaagtgccataaac
accagggacctaaaaagagttccttggggagggctggacacagttaatcagctagcttgt
cacagcggtcctggtgaagagagctctgctggaaattcactttgtgtggtgtttgaaaat
ataggctgttcatttgggatcataatatatgcacagagtggcaacaaggagaaacctcag
cgttctaattactacattgtagtaaacagttcatttgtctattatgtgtgctttgacttt
tctaccccttcaagacctggctatacagtgtttgctttattttaa

DBGET integrated database retrieval system