KEGG   Falco peregrinus (peregrine falcon): 101924342Help
Entry
101924342         CDS       T02856                                 

Gene name
HAT1
Definition
histone acetyltransferase 1
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
Enzymes [BR:fpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101924342 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 402 aa AA seqDB search
MEKKLAEYKCNTNEAIQLKLVRFPEDLEDDNTTFNPEYSHQVFGDDEVAFGYKGLKILLY
YIAGNLSTLFRIEYTSKVNEKFDCVEADDVESKIREIIPPGFCTNTDDFVSLLEKEVNFK
PFGMLLHTYSVHNEEAGEDITYQIYKADMTCTGFREYHERLQTFLMWFIETASFIDVDDE
RWNYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILPPFQGEGHGAQLL
ETVHRYYMSSPTVLDITAEDPSENYVKLRDFVLVKLCQDLLCFSPGKLMQGFTQEMVMEA
QQKLKINKQHTRRVYEILRLRATDMGDAEQSRSYRLDVKRRLIGPYKKKQRELAKMRRCL
RPEELTNQLNQIDLNMQHEQLEESFQQLVSDYRRVLERLAQA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaagctggctgaatacaagtgtaatacaaatgaagcaattcagctgaaacta
gttcgctttcctgaggatttggaggatgacaacacaacatttaatccagagtatagccat
caagtgttcggagacgatgaagttgcttttggatacaagggactgaagatcctcttgtac
tatattgctggtaacctgtcaacgctctttcgcatcgaatatacatctaaagttaatgaa
aagtttgactgtgtggaggcagatgatgttgaaagtaaaattagagaaatcattcctcct
ggcttttgcacaaacacagatgactttgtgtctcttctggagaaggaggtcaacttcaag
ccctttggaatgctgctacacacatattctgtccataatgaggaagctggtgaagatata
acatatcagatatacaaggccgacatgacatgtacaggctttcgagaatatcatgaaagg
cttcagacgttcttgatgtggtttattgaaactgctagctttattgatgtagatgatgaa
agatggaactactttctagtatttgagaagtataataaggatggagctacgctctttgcg
accgtaggctacatgacagtctataattactatgtgtacccagacaaaacccggccacgt
gtaagccagatgctgatcttgccaccattccaaggagaaggccatggtgctcagctgctt
gaaacagttcatagatactatatgtcttctcctacagtacttgatataacagctgaagat
ccatctgaaaactatgtgaagctaagagactttgtccttgtaaagctctgtcaagatttg
ctttgtttttccccaggaaagttaatgcaaggtttcacccaagaaatggtgatggaagct
caacaaaaactgaaaataaataagcaacacacaagacgagtttatgaaattctccgattg
cgtgcaacagatatgggtgatgcagaacagtccagaagctatcgattggacgttaaaaga
agactgattggcccttataagaaaaagcagagagaacttgccaagatgagaaggtgtcta
agaccagaggagctgacgaaccagttgaaccaaatagacctaaacatgcaacatgaacag
ttagaagagagcttccaacaacttgtttcagattaccgaagagtcctagaacgacttgca
caagcctga

DBGET integrated database retrieval system