KEGG   Falco peregrinus (peregrine falcon): 101924619Help
Entry
101924619         CDS       T02856                                 

Gene name
UGT2A1
Definition
(RefSeq) UDP-glucuronosyltransferase 2A1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00040  Pentose and glucuronate interconversions
fpg00053  Ascorbate and aldarate metabolism
fpg00140  Steroid hormone biosynthesis
fpg00830  Retinol metabolism
fpg00860  Porphyrin and chlorophyll metabolism
fpg00980  Metabolism of xenobiotics by cytochrome P450
fpg00982  Drug metabolism - cytochrome P450
fpg00983  Drug metabolism - other enzymes
fpg01100  Metabolic pathways
Module
fpg_M00014  Glucuronate pathway (uronate pathway)
fpg_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101924619 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    101924619 (UGT2A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101924619 (UGT2A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101924619 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    101924619 (UGT2A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101924619 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    101924619 (UGT2A1)
   00983 Drug metabolism - other enzymes
    101924619 (UGT2A1)
Enzymes [BR:fpg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101924619 (UGT2A1)
Glycosyltransferases [BR:fpg01003]
 Others
  Hydrophobic molecule
   101924619 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 101924619
NCBI-ProteinID: XP_013155148
Position
Un
AA seq 526 aa AA seqDB search
MAGKEVAALWLLPGLGWVSGGKVLVCPADNSHCLNMEYILQELVVRGHEVTVLLPSCFLF
LNVTQPSPFRFEVVEVPITKKEMATLLEDFLYFWVYQEKVLPVWESIYKIVQLVLKLENI
TKVICDEVLKNKALLERLRASTFDVLLADPLSPSGELFAEKLAIPFVYTIRFSIGNTLER
LCGTLPAPPSYVPATPSGLTERMSFLERLKTIFIYTVQDIMYHYVLWGSCDQYYSDVLGR
PTTLCETMGKAEIWLIRTYWDFEFPRPFLPNFEFVGGLHCQPAKPLPKEMEEFVQSSGEH
GIVVFSLGSMVYNLSYEKSNVIARALSQIPQKVLWRYKGKNPETLGSNTRIYDWIPQNDL
LGHPLTKAFITHGGTNGIYEAIYHGIPMIGIPMFADQHDNIAHMRAKGAATELDFSTLET
QDLVDALNTVINNSTYKENALRLSKIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAAHH
LTWYQYHCLDVLAFLFTCTAIAVFILVKCCLFCCRRCGRIAKRKKE
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggctgggaaggaggtggcagcgctgtggcttctgcctgggctgggctgggtgtctggg
ggcaaggtattggtctgcccagctgacaacagccactgcctgaacatggagtacatactc
caggagctcgtggtccggggccatgaggtgactgtgctgctgccttcatgcttcctcttc
cttaatgtcacacagccctcacctttccggtttgaggtggttgaggtgccgatcaccaaa
aaggagatggctacgttattggaagattttttatatttttgggtttaccaggagaaagtg
ctacctgtctgggaaagcatttacaagatagttcaactagtattaaagctggagaacata
accaaagtaatttgtgatgaagtcctgaagaacaaggcactgctggagagactgagggca
tccacctttgatgtcctcttggcagacccactgtcacccagtggggagctgtttgccgag
aagctggctatccccttcgtgtacaccatccggttctccataggcaacacgctggagcgg
ctctgcgggacactcccagcacctccttcctacgtaccagccacaccaagtggcctaaca
gagaggatgtccttcctggaaaggctaaaaaccatcttcatctacactgtgcaagatatc
atgtatcattatgttctctggggaagctgcgatcaatactacagtgatgttttaggaagg
cccacaaccctgtgtgagacaatgggaaaagcagagatatggttaatcagaacatactgg
gattttgaatttccacgccctttcctgcccaactttgagtttgttggaggacttcattgc
cagcctgcaaagccgttaccaaaggaaatggaagaatttgttcagagctcaggggaacac
ggcattgtggtattctcccttggatcgatggtctacaacctaagttacgaaaaaagtaat
gtgattgccagagccctcagccagattccacaaaaggtcctctggcggtacaaaggaaaa
aacccagaaactctgggctccaacaccaggatatatgactggataccccaaaatgatctg
cttggccatcccttgacgaaggcctttattactcatggtgggaccaatgggatctatgaa
gctatctaccatgggatcccgatgattgggattcccatgtttgccgaccagcatgacaac
attgctcacatgagggcaaagggagctgcgaccgagctggatttcagcacactggagaca
caggacctagttgatgcactgaatacagtcattaacaattccacctataaggaaaatgct
ctaaggttatccaagatacaccatgaccagccagttaagcctctggacagagctgtcttc
tggattgaatttgtcatgcgacacaaaggagcaaagcacctgagaccagctgctcaccat
ctcacctggtaccagtaccactgcctggatgttctggcgttcttgttcacctgtacagcc
attgctgtcttcattcttgtcaaatgctgcttattttgctgtaggagatgtggcaggatt
gcaaagaggaagaaagaatag

DBGET integrated database retrieval system