KEGG   Falco peregrinus (peregrine falcon): 101924619Help
Entry
101924619         CDS       T02856                                 

Gene name
UGT2A1
Definition
UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101924619 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    101924619 (UGT2A1)
   00500 Starch and sucrose metabolism
    101924619 (UGT2A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101924619 (UGT2A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101924619 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    101924619 (UGT2A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101924619 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    101924619 (UGT2A1)
   00983 Drug metabolism - other enzymes
    101924619 (UGT2A1)
Enzymes [BR:fpg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101924619 (UGT2A1)
Glycosyltransferases [BR:fpg01003]
 Others
  Hydrophobic molecule
   101924619 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 533 aa AA seqDB search
MATKAMGSKKYLQLLLFQVALLGPVFCGNMLVWPTEGSHWLNVKIIIEELIRRGHSITIL
VSNASLFIKPRAEATENFVVYNVPFKKDTIENLIEDVVALWLNNRPTTLTFWQFYKELGK
LSKNWHQMNRLMCDAVLTNRELMAHLQGSGYDLLLSDPVTLCGDLLALKLAIPFIYSLRF
SPASTVERHCGKIPAPPSYTPAALSELTDCMSFGERIKNIVSYHLQDYVFQSYWGEWDIY
YSKVLGRPTTLCETMGKAEIWLIRTYWDFEFPRPFLPNFEFVGGLHCQPAKPLPKEMEEF
VQSSGEHGIVVFSLGSMVYNLSYEKSNVIARALSQIPQKVLWRYKGKNPETLGSNTRIYD
WIPQNDLLGHPLTKAFITHGGTNGIYEAIYHGIPMIGIPMFADQHDNIAHMRAKGAATEL
DFSTLETQDLVDALNTVINNSTYKENALRLSKIHHDQPVKPLDRAVFWIEFVMRHKGAKH
LRPAAHHLTWYQYHCLDVLAFLFTCTAIAVFILVKCCLFCCRRCGRIAKRKKE
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggccacaaaagctatggggtctaagaaatacctccagctgctcctttttcaggtcgct
cttctagggcctgtcttctgtgggaacatgttggtctggccaacagaaggcagccactgg
ctgaatgtgaagataattatagaggagctcatccgccgtgggcacagcattaccatcctg
gtatccaacgcttccctcttcattaaacccagggctgaggccactgagaattttgtggtc
tataacgtgcccttcaagaaagacaccattgagaacctgatcgaggacgtagtggccctg
tggctgaataacaggccaaccaccctgaccttctggcagttttacaaggagcttggaaaa
ctgtccaaaaactggcaccagatgaataggctaatgtgtgatgcggtgctaaccaaccga
gagctgatggcacacctgcagggctctggctatgacctgctgctgtcagaccctgtgact
ctctgcggggacctcctggctcttaagctggccattccattcatctactcgctgcgcttc
tccccagcctccactgtggaaaggcactgtggcaagatcccagctccaccgtcctacaca
cctgcagccctgtctgagctcaccgactgcatgtcctttggtgagagaataaaaaatatc
gtgtcttaccacctgcaggactacgttttccagagctactggggtgaatgggatatctac
tatagcaaggtcttaggaaggcccacaaccctgtgtgagacaatgggaaaagcagagata
tggttaatcagaacatactgggattttgaatttccacgccctttcctgcccaactttgag
tttgttggaggacttcattgccagcctgcaaagccgttaccaaaggaaatggaagaattt
gttcagagctcaggggaacacggcattgtggtattctcccttggatcgatggtctacaac
ctaagttacgaaaaaagtaatgtgattgccagagccctcagccagattccacaaaaggtc
ctctggcggtacaaaggaaaaaacccagaaactctgggctccaacaccaggatatatgac
tggataccccaaaatgatctgcttggccatcccttgacgaaggcctttattactcatggt
gggaccaatgggatctatgaagctatctaccatgggatcccgatgattgggattcccatg
tttgccgaccagcatgacaacattgctcacatgagggcaaagggagctgcgaccgagctg
gatttcagcacactggagacacaggacctagttgatgcactgaatacagtcattaacaat
tccacctataaggaaaatgctctaaggttatccaagatacaccatgaccagccagttaag
cctctggacagagctgtcttctggattgaatttgtcatgcgacacaaaggagcaaagcac
ctgagaccagctgctcaccatctcacctggtaccagtaccactgcctggatgttctggcg
ttcttgttcacctgtacagccattgctgtcttcattcttgtcaaatgctgcttattttgc
tgtaggagatgtggcaggattgcaaagaggaagaaagaatag

DBGET integrated database retrieval system