KEGG   Falco peregrinus (peregrine falcon): 101924635Help
Entry
101924635         CDS       T02856                                 

Gene name
SIRT6
Definition
(RefSeq) sirtuin 6
  KO
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
Enzymes [BR:fpg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101924635 (SIRT6)
Chromosome [BR:fpg03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     101924635 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 357 aa AA seqDB search
MDILGQVPMDIPGQGPMSLCNLDHPGIFDPPEEVERKVQELADLIRSSSNVVFHTGAGIS
TASGIPDFRGPNGVWTMEEKGLSPKFDTTFENARPSKTHMALLGLQRVGILKFLVSQNVD
GLHVRSGFPRDKLAELHGNMFVEECVKCGKQYVRDAVVGSMGLKPTGRLCSVTKARGLRA
CRGKLRDTILDWEDSLPDRDLTLADEACRKADLSITLGTSLQIKPSGNLPLITKKRGGKL
VIVNLQATKHDRQADLRIHAYVDDVMTKLMKHLGLEVPEWTGPVVVETAELTKPEQLFKF
DPGARRLLKEEHNGMEGLCPDLGTTLVEHRDSLKQECPSPDTGPTTVKKMKVEPLLT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggacatcctggggcaggtccccatggacatcccgggacagggtcccatgtccttgtgc
aacctggatcatcctgggatttttgaccccccggaggaagtggagaggaaggtgcaggag
ctggcagacttgatcaggagttcctccaatgtggtgtttcacacgggggctgggatcagc
actgcctcggggattcccgacttcaggggccccaatggtgtctggactatggaagagaag
gggctctccccaaaattcgacaccacctttgagaatgccaggccctccaagactcacatg
gcattactggggctgcagagagttggcatcctgaaattcctggtcagccagaatgtggac
ggccttcacgtgcgttcaggattcccacgggacaaattggctgagctccacgggaacatg
tttgtggaagagtgtgtgaaatgcggcaagcagtacgtgcgggacgcagtcgtgggcagc
atggggctgaagccaacgggcaggctgtgcagcgtcaccaaagcccgggggctgcgggcc
tgcagggggaagttaagagacaccattctggactgggaggattccctgcctgaccgcgac
cttacgctggcggatgaagcctgcaggaaagctgatctctccatcaccctggggacctct
ctgcagatcaaacccagcggcaacctcccgctgatcacgaagaagagaggagggaagctg
gtcatagtcaatctacaagcaaccaaacacgacagacaggccgacctgcgcatccacgcc
tacgtcgacgatgtcatgacgaagctgatgaagcacttggggctggaggtcccggagtgg
acggggccagtggtggtggaaaccgctgagctcaccaagcccgaacagctcttcaaattt
gaccctggggcccgcaggctgctgaaggaggagcacaatggcatggaagggctgtgccct
gaccttgggaccacactggtggagcaccgtgacagtctgaagcaggagtgtcccagccca
gacacagggccaacgacggtgaagaagatgaaggtggagcctctcctcacctga

DBGET integrated database retrieval system