KEGG   Falco peregrinus (peregrine falcon): 101924763Help
Entry
101924763         CDS       T02856                                 

Definition
beta-galactoside alpha-2,6-sialyltransferase 1-like
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    101924763
   00514 Other types of O-glycan biosynthesis
    101924763
Enzymes [BR:fpg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     101924763
Glycosyltransferases [BR:fpg01003]
 Terminal extension
  Sialyltransferase
   101924763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 415 aa AA seqDB search
MVHINVLKKLMCVLVVVLVALTVCLWRETRRSYYISFKTGNDDLQVHRTLEKWNPLKSQG
FFREAAGELGEMPKVWFGNHNKVKSSTSGMAEKSKKAADSVKVWDKDSSSRNLIPRLQKV
RMNYLSMNKYNVTYTGKRNAAKLSPEKLLCQLRDRVNVTMIQGSDGPFGTSEWQQYLPGK
SLNETVGSLGRCAVVSSAGSLKSSHLGQEIDTHDAVLRFNGAPISGFQEDVGQKTTIRLV
NSQLVTVEEQQFLREALYNTGILIVWDPAPYHAEIHEWYRKPDYNFFESYKSYRSAHPEQ
PFYILNPKMQWQLWDILQENSLEHIQPNPPSSGMLGIVIMMTLCDEVDVYEFLPSKRQTD
ICHYYQKFHDRACTMGAYHPLLFEKNLVKHINQGTDEDIYTHGKVTLPGFRKVHC
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggttcacatcaatgtgttgaaaaaattaatgtgtgttcttgtggtggtactggtagca
ctgacagtttgcctgtggagagagacgagaagaagctactacatttctttcaagactggg
aacgatgatttgcaggttcacaggactctggaaaaatggaacccacttaaatcccagggc
tttttccgtgaagcagctggtgaactgggtgagatgcccaaagtgtggtttggtaaccac
aacaaagtaaaaagcagcacctctggaatggctgaaaaatccaagaaagcagcagacagc
gtgaaggtatgggataaggacagttcatccagaaatctcatacccaggctgcagaaggtc
agaatgaactacctgtccatgaacaagtacaacgtgacttacaccggcaagaggaatgct
gctaaactcagtccagagaagctgctctgccagctacgggacagagtgaatgtgaccatg
atacagggatcggatggtccttttggcacctctgaatggcagcaatacctaccagggaaa
agcctcaatgaaacagtgggcagcctgggtcgctgtgctgtcgtctcctcagcaggatct
ctgaaatcatctcatttgggacaagagatagacacccacgatgccgtcttgcgattcaac
ggggctcctatcagcggctttcaagaagatgtggggcaaaagaccacaattcgtcttgtg
aactcccagcttgtcactgttgaggagcagcagttcctgagggaagcactgtataacact
ggaatcttaattgtctgggatccagcaccatatcatgcagaaattcatgagtggtacaga
aaaccagactacaacttttttgaaagctataagtcataccgtagtgcacatccagagcag
cctttctatatcctgaatccaaaaatgcagtggcaactttgggatattctgcaggagaat
tctctggagcatattcaacctaatccgccatcatcaggaatgcttggcatcgtgatcatg
atgacgctctgcgatgaggtggacgtgtatgaatttctcccttccaaacggcagacggac
atttgccactattaccagaagtttcacgaccgtgcgtgtaccatgggagcttaccacccc
ctcctgtttgagaaaaacttggtgaaacatataaaccagggcacagatgaggacatctat
actcacgggaaagttactttgcccggcttccgaaaggtgcattgctag

DBGET integrated database retrieval system