KEGG   Francisella philomiragia: Fphi_0068Help
Entry
Fphi_0068         CDS       T00652                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
fph  Francisella philomiragia
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fph01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:fph00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(62164..63462)
Genome map
AA seq 432 aa AA seqDB search
MIEIYNWQELSLVKQAELLSRPVSANKASLVAGVRNILNAVKQNGDKALLEFTSRFDGVD
LDNIEVSAHEIKEAYSLVSQDDIELVKNSIARISNYHEVMKPKTTVCDTNDGVVCKKIYK
PIEKVGLYVPGGSAPLVSTLIMLAAPAQIAGCKEIYVTTPCDKEGNIHPLILIAADICKV
SKIYKLGGAQAIAALAYGTETVTKVNKIYGPGNSWVTEAKQQVSNDSQGAAIDLPAGPSE
VLVVADEVADARFVAADLLAQAEHGTDSQALLITTSQILADKVRDEVSKQTSTAQRKAII
EKALENSAIIVVDTLSQAINIANEYASEHLILNIETADNYIDSIENAGAVFVGPWAAEAL
GDYITGSNHVLPTYGYAKAYSGLATIDFMKAISIQNVSKQGIKNIGQIAMRLADIEGLKA
HENAIAIRLESL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaatatataattggcaagaacttagtctagtaaagcaagcagagcttctatct
cgcccagtttctgctaataaagcaagcttagttgcaggtgttagaaatattttaaacgct
gttaagcagaatggtgataaagctcttttggagtttacttctaggtttgatggtgttgat
ttagataatattgaagtctcagcacatgagattaaagaagcttactcattagtttcacaa
gatgatattgagttagttaaaaactctattgcgcgtatatctaactatcatgaggtaatg
aaaccaaaaacaactgtttgtgatactaatgatggtgtggtttgtaaaaaaatctataag
cctatcgaaaaggttggtttatatgtgcctggtggttcagcacctttagtttctacgcta
ataatgttagcggctccagcgcaaattgcaggttgtaaagagatttatgtaactactcct
tgtgataaagaaggcaatatccatccattaattttaatagcggctgatatttgtaaggtt
tcaaagatttataaattaggtggcgctcaagctatagctgctctagcttatggtacagaa
actgtaacaaaagttaataaaatttatggccctggaaattcttgggttacagaggcaaaa
caacaagtatctaatgatagccaaggtgctgctattgatctaccagctggaccctcagag
gttttagtagttgctgatgaagtggccgatgctagatttgttgctgcagatctattagct
caagctgagcatggcacagactcacaagctttattaattacaactagtcaaattttagct
gataaggttagagatgaggtttctaagcaaactagtacagcccaaagaaaagctattatt
gaaaaagctttagaaaatagcgcaattattgttgtagatacacttagccaagcaattaat
atagctaatgaatatgcttctgagcatcttattttaaatattgaaactgcagataattat
attgatagtatcgaaaatgcaggtgctgtatttgtaggtccttgggcggctgaagcatta
ggtgattacattacaggatctaatcatgtgttacctacttatggatatgcaaaagcctat
agcggtttagcaactatagattttatgaaagctataagtatccaaaatgtatcaaaacaa
ggtataaaaaatataggtcaaatagcaatgagattagctgatatagaaggtctcaaagct
catgaaaatgcaatagctattcgtttggagagtttataa

DBGET integrated database retrieval system