KEGG   Francisella philomiragia: Fphi_0068Help
Entry
Fphi_0068         CDS       T00652                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
fph  Francisella philomiragia
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fphi_0068
  Amino acid metabolism
   00340 Histidine metabolism
    Fphi_0068
Enzymes [BR:fph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Fphi_0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(62164..63462)
Genome map
AA seq 432 aa AA seqDB search
MIEIYNWQELSLVKQAELLSRPVSANKASLVAGVRNILNAVKQNGDKALLEFTSRFDGVD
LDNIEVSAHEIKEAYSLVSQDDIELVKNSIARISNYHEVMKPKTTVCDTNDGVVCKKIYK
PIEKVGLYVPGGSAPLVSTLIMLAAPAQIAGCKEIYVTTPCDKEGNIHPLILIAADICKV
SKIYKLGGAQAIAALAYGTETVTKVNKIYGPGNSWVTEAKQQVSNDSQGAAIDLPAGPSE
VLVVADEVADARFVAADLLAQAEHGTDSQALLITTSQILADKVRDEVSKQTSTAQRKAII
EKALENSAIIVVDTLSQAINIANEYASEHLILNIETADNYIDSIENAGAVFVGPWAAEAL
GDYITGSNHVLPTYGYAKAYSGLATIDFMKAISIQNVSKQGIKNIGQIAMRLADIEGLKA
HENAIAIRLESL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaatatataattggcaagaacttagtctagtaaagcaagcagagcttctatct
cgcccagtttctgctaataaagcaagcttagttgcaggtgttagaaatattttaaacgct
gttaagcagaatggtgataaagctcttttggagtttacttctaggtttgatggtgttgat
ttagataatattgaagtctcagcacatgagattaaagaagcttactcattagtttcacaa
gatgatattgagttagttaaaaactctattgcgcgtatatctaactatcatgaggtaatg
aaaccaaaaacaactgtttgtgatactaatgatggtgtggtttgtaaaaaaatctataag
cctatcgaaaaggttggtttatatgtgcctggtggttcagcacctttagtttctacgcta
ataatgttagcggctccagcgcaaattgcaggttgtaaagagatttatgtaactactcct
tgtgataaagaaggcaatatccatccattaattttaatagcggctgatatttgtaaggtt
tcaaagatttataaattaggtggcgctcaagctatagctgctctagcttatggtacagaa
actgtaacaaaagttaataaaatttatggccctggaaattcttgggttacagaggcaaaa
caacaagtatctaatgatagccaaggtgctgctattgatctaccagctggaccctcagag
gttttagtagttgctgatgaagtggccgatgctagatttgttgctgcagatctattagct
caagctgagcatggcacagactcacaagctttattaattacaactagtcaaattttagct
gataaggttagagatgaggtttctaagcaaactagtacagcccaaagaaaagctattatt
gaaaaagctttagaaaatagcgcaattattgttgtagatacacttagccaagcaattaat
atagctaatgaatatgcttctgagcatcttattttaaatattgaaactgcagataattat
attgatagtatcgaaaatgcaggtgctgtatttgtaggtccttgggcggctgaagcatta
ggtgattacattacaggatctaatcatgtgttacctacttatggatatgcaaaagcctat
agcggtttagcaactatagattttatgaaagctataagtatccaaaatgtatcaaaacaa
ggtataaaaaatataggtcaaatagcaatgagattagctgatatagaaggtctcaaagct
catgaaaatgcaatagctattcgtttggagagtttataa

DBGET integrated database retrieval system