KEGG   Francisella philomiragia: Fphi_0116Help
Entry
Fphi_0116         CDS       T00652                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fph  Francisella philomiragia
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fph00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Fphi_0116
DNA repair and recombination proteins [BR:fph03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Fphi_0116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
114890..115495
Genome map
AA seq 201 aa AA seqDB search
MNNQIFSPKITAVIESLRKLPTIGKKSSQRLALYLLDKSPETAITIANSLLDAAENIKKC
KYCQSLTEKDVCDICGSQNRDESKLCIIESMLDLVAIEEAGFFKGKYFVLNGRISPLDGI
GPNELKLDILEQIIINREINEIILAISPTVEGETTAHFISQMIGKDIKISRIGFGVPFGG
ELEYLDQQTLIHAFNARTNIK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatcaaattttctctcccaaaattactgctgtaatagaatctttgcgtaaatta
ccaactattggtaaaaaatcgtctcaaagacttgcattatatttacttgataaatctccg
gaaaccgctattacaattgctaactctctgttagatgcagctgaaaatatcaaaaaatgt
aaatattgccaatctcttactgaaaaagatgtttgtgatatctgtggtagccaaaataga
gatgaatctaaattatgcataattgaaagtatgctagatttggtagctattgaagaagca
ggttttttcaaaggaaaatacttcgtacttaatggcagaatatctccgcttgacggaata
ggaccaaatgaactaaaacttgatattttagagcaaataattataaatagagaaataaat
gagattatattagctataagccccactgtagaaggagaaacaactgcgcactttatttct
caaatgattggtaaggatataaaaatctctagaattggctttggagttccttttggtggt
gaattagaatatttagatcaacaaacattaattcacgcttttaatgccagaactaatatc
aaataa

DBGET integrated database retrieval system