KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_0225Help
Entry
Fphi_0225         CDS       T00652                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
fph00010  Glycolysis / Gluconeogenesis
fph00052  Galactose metabolism
fph00500  Starch and sucrose metabolism
fph00520  Amino sugar and nucleotide sugar metabolism
fph00521  Streptomycin biosynthesis
fph01100  Metabolic pathways
fph01110  Biosynthesis of secondary metabolites
fph01120  Microbial metabolism in diverse environments
fph01130  Biosynthesis of antibiotics
fph01200  Carbon metabolism
Module
fph_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fphi_0225
   00052 Galactose metabolism
    Fphi_0225
   00500 Starch and sucrose metabolism
    Fphi_0225
   00520 Amino sugar and nucleotide sugar metabolism
    Fphi_0225
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Fphi_0225
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Fphi_0225
Enzymes [BR:fph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Fphi_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ABZ86441
JGI: Fphi_0225
UniProt: B0TZ02
Position
complement(237437..238402)
Genome map
AA seq 321 aa AA seqDB search
MYIGLDIGGSNISAGIFDEHKNLLKTAKVKSKGKSDSDTILGQIFKVINKLLDDSTRDKI
KAIGIGIAGFVDSKNGILNFSANINLNGINIAKEVSQKFGNVPVFIENDVNVGVIGEWKY
GVGQGHENIVGIFAGTGIGGGLVINNQFLYGVTGGAGAVGHVSINTQGTYCQSCGSQGCV
ETYAGKVGMENRILNLHKKGVKSLLIDLVLENNNKLKGSHLKKALDAKDSVAEDIVNLAM
TNLGIAIANYINLLNPSLVLLGGGVMEAIGHKYLNTIYNSCSKYAFKTMLEACELKIATL
GDNSGVYGAMDIAVNRLEGNW
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtatataggtttagatattggtggtagtaatatttcagcaggaatttttgatgaacat
aaaaatctacttaagacagccaaggtaaaatcaaaaggcaagagtgactctgatacaatt
ttgggtcaaatttttaaagttattaacaagttgcttgatgattcaacaagagacaaaata
aaggctataggtattggtatagctggatttgtagattcaaaaaatggtattttaaatttt
agtgcgaatatcaatctcaacggtataaacatagctaaagaagttagtcaaaaatttggt
aatgtaccagtatttattgaaaatgatgtcaatgtaggtgttattggtgaatggaaatac
ggagttgggcaaggtcatgaaaatatcgttggtatatttgcaggcacaggaattggcggt
ggtctagttataaataatcagtttttatatggagttaccggtggtgccggagctgtagga
catgttagtatcaatacccaaggcacttattgccaaagttgtggttcacagggttgtgtt
gagacttatgctggtaaagtaggtatggaaaataggattctaaacctgcataaaaaaggt
gttaaaagcttacttatagatttggttttagaaaataacaataagcttaagggatcacat
ttgaaaaaagcactagatgctaaagattctgtggcagaagatattgtcaatctggcaatg
acaaatttgggtattgctatagctaattatataaatcttttgaatccatcattggtattg
ttgggtggtggtgttatggaagctattggacataaatatttgaatactatttataattca
tgttcaaagtatgcttttaaaacaatgttagaggcatgtgaattgaagatcgcaacatta
ggcgacaactcaggtgtttatggtgctatggatatagcagttaatagattagaaggaaat
tggtaa

DBGET integrated database retrieval system