KEGG   Francisella philomiragia: Fphi_0238Help
Entry
Fphi_0238         CDS       T00652                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
fph  Francisella philomiragia
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:fph03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
250360..251229
Genome map
AA seq 289 aa AA seqDB search
MLSYSNLNFYSNIKFMPELPEVETVKRGLTKNIISKKIKSVQINTDKLRYPVDKAQLLSL
KNKVVKNIQRRGKHLIIYLEDNLQLIIHLGMSGVVKIINTSEYNKIKHDHIILELSDDLN
LVYNDPRKFGYWLVNTNKMPLEHRVLATHGVEPLTDDFNTEYLISKLKKTSRKIKQTIMD
NSIVVGVGNIYASEALFDSNILPTRASNTITKKEAERLVTSIKKILDKAIAEGGTTLKDY
KNTEGKPGYFTQQLNVYGRANQNCYVCSTKIESLVIAQRNTFFCKKCQR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgttatcatatagtaatcttaatttttatagtaatatcaaatttatgcctgaacttcct
gaagtagagactgtcaaaagaggtttaaccaaaaatattattagcaaaaagattaaaagt
gtacagataaatacggataagcttcgctatcccgtagataaagcccaacttctatcactg
aaaaacaaagtcgtaaaaaatattcaaagaagaggtaagcatctaattatttatctagaa
gataacttacagttaattattcatctaggtatgtcaggtgtcgttaaaattataaatact
tctgaatacaacaagatcaaacatgaccacattattttagagttatctgatgatttaaat
ctagtctataatgatccgcgtaaatttggatattggttagtcaatactaataagatgcca
ctagaacacagagttttagccactcatggagttgaacctttaacagatgatttcaatact
gaatatttgatatctaaattaaagaaaacctctagaaaaatcaaacaaactatcatggat
aatagcatagttgttggcgtaggaaatatatatgccagtgaagcattatttgatagtaat
atcttacccacaagagcttctaacaccatcacaaaaaaagaagctgagaggcttgtaacc
tcaattaagaaaatacttgataaagcaattgccgaaggtggtacaacactcaaggactat
aaaaatacagaaggtaaacccggctacttcacgcaacaactcaatgtttatggcagagcc
aatcaaaactgttacgtctgtagtactaaaatcgagagtttagtgatagcccaaagaaac
acattcttttgcaaaaaatgtcaaagataa

DBGET integrated database retrieval system