KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_0284Help
Entry
Fphi_0284         CDS       T00652                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
fph00860  Porphyrin and chlorophyll metabolism
fph01100  Metabolic pathways
fph01110  Biosynthesis of secondary metabolites
fph01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Fphi_0284
Enzymes [BR:fph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Fphi_0284
Exosome [BR:fph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Fphi_0284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD RE_NgoPII
Motif
Other DBs
NCBI-ProteinID: ABZ86500
JGI: Fphi_0284
UniProt: B0TZ61
Position
complement(302573..303544)
Genome map
AA seq 323 aa AA seqDB search
MSFPISRPRRLRVTQAFRDMVAETKLNIDDLMYPIFVVHGNGIKKEISSMPNQYHWSVDM
LDELVEQVIKLGIKSLMIFGVPKTKDLISSENYDPNGITQQAIRKIKQLAPELVVATDVC
MCSFTPHGHCGILDEHDYVDNDRTLEILQKTAISHAQAGADIVAPSGMMDGMIIAMRQAL
DESGFETVSIMSYSVKYASAYYGPFRSACSSSLKGDRKTYQMDYRNKKEAIREALADVEQ
GADFIMVKPALSYLDIINELSHIIELPIAAYHVSGEYAMIKAAANAGLVDEKAITIETLT
SMKRAGAKIILTYTALDVANWIR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagttttccaatatcacgcccacgtagacttagagttactcaagcctttcgagatatg
gttgcagagacaaaattgaacatagatgatttgatgtatccaatatttgttgtgcatggt
aatggtatcaaaaaagaaatctcaagtatgccaaaccaatatcattggtcagtagatatg
cttgatgagcttgttgagcaggttataaaattaggtataaaaagtttgatgatatttggt
gtaccaaaaaccaaagatcttatatcatcagagaactatgatccaaatggtataacgcaa
caagcaatcagaaaaattaaacaacttgctccagagcttgtagtagctacagatgtgtgt
atgtgtagttttacacctcatggacactgtggtattttggatgagcatgattatgttgat
aatgatcgaacattagaaatattacaaaaaacagctatttctcatgcacaagctggtgca
gatattgttgcaccaagtggaatgatggatggcatgataattgcaatgcgtcaagcattg
gatgagtcaggatttgaaactgtgagtattatgtcatactcagttaagtatgcttcagca
tattatggtccatttagaagtgcttgtagttcatctcttaagggagatcgtaaaacgtat
cagatggattatcgtaataaaaaagaggctatccgtgaagctctagcagatgttgaacaa
ggtgcagactttattatggttaaaccagcattgagttatttagatattattaatgaactg
agtcatataatagagttgccaatagcagcatatcatgtcagtggagaatatgcgatgatt
aaagctgctgcaaatgcaggtctagttgatgaaaaagcaatcactatagaaacattgaca
tcgatgaaaagagcaggcgctaaaataattcttacttatacagctttagatgttgcaaac
tggattagatga

DBGET integrated database retrieval system