KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_0311Help
Entry
Fphi_0311         CDS       T00652                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fphi_0311
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fphi_0311
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Fphi_0311
Enzymes [BR:fph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Fphi_0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(333075..334361)
Genome map
AA seq 428 aa AA seqDB search
MNFISTRDKNIKVSLSEAMQSGLAPDGGLFVPERFPTVDWQNFAKDISYAEFAANMLREF
FKGDQLEASLDKICNNAFTFDVPVKRLDKTTSVLELFHGPTLSFKDFGARFLANCLSSID
SDKPFTILVATSGDTGSAVAAAFHGKSNIRVIVMFPKDKISKRQEKQITCWGDNIQAVEV
EGVFDDCQSLVKEAFKTPWWTERTKLNTSNSINIGRLLPQSTYYAYTSWQHYLQTGEKAN
YIVPSGNIGNITAAFWAKQMGFPIGEISMSLNANDTVIDYLNTGEFNPRASVETLANAMD
VGNPSNFERLLYLLGNYENFKANIKAVCVSDFEIIEEIKQVYRQYNEVVCPHTATGFVAK
NQLDANKDYIIVATAHPAKFESVIEPILDMQVPATPALQKLLDKEQHKVAINKSMDELCE
VYTRAFDA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaattttattagtacaagagataaaaatatcaaagtttcattgagtgaggcaatgcag
tctggattagctccagatggaggactgtttgtgcctgagagatttccaacagttgattgg
cagaattttgccaaagatataagctatgctgaatttgctgcaaacatgctaagagaattt
ttcaaaggcgatcagctggaagcttctttagataagatttgtaataatgcatttaccttt
gatgtgcctgttaaacgtttagataaaaccacatcagttttagaactttttcacgggcca
actttatcttttaaagattttggtgcgagatttttagcaaattgtctaagctctatagat
agcgataaaccatttaccatcttagtggcaacttctggtgatacaggttcagcagtagca
gcagcttttcatggtaagagtaatattcgtgttatagtgatgttccctaaagataaaatc
tctaaaagacaagaaaaacaaataacttgctggggcgataatatccaagctgttgaagtt
gaaggagtttttgatgattgtcaaagtttagttaaagaagcttttaagacaccttggtgg
acagaaagaacaaaactaaatacatctaatagtattaatattggtagattattaccacaa
tctacttactatgcttacacatcgtggcagcattatttacagactggagagaaagcaaat
tacatagttccatctggtaatattggtaatatcacagcagcattttgggctaaacaaatg
ggcttcccaataggtgagatatctatgagtctaaatgcaaatgatacagtgatagattat
ttaaatactggagaatttaacccaagagcaagtgttgagacattggcaaatgcaatggat
gtgggtaaccctagtaattttgaacgattattatacttgctagggaattatgaaaatttc
aaagctaatattaaagctgtatgtgtttctgattttgaaatcatagaagaaattaagcaa
gtttatcgtcagtataatgaagttgtttgcccacacactgcaacaggttttgtagcaaaa
aatcagcttgatgctaataaggattatataatcgtagcgactgcacatcctgctaaattt
gagagcgtaattgagccaatattagatatgcaggttccagctacgccagcgttacagaag
ctactagataaagaacaacataaagtagcgataaacaagtctatggatgaactttgtgaa
gtctatacaagagcttttgatgcttaa

DBGET integrated database retrieval system