KEGG   Francisella philomiragia: Fphi_0322Help
Entry
Fphi_0322         CDS       T00652                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fph  Francisella philomiragia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fph00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(345978..347402)
Genome map
AA seq 474 aa AA seqDB search
MKKSGLLLAISSLPSQFGIGDLGKSAYEFVDILKQANTKIWQVLPLTPLGFGNSPYQSSS
SFAGDEIYISLEKLADYGLLEESSLKSLNVNSDKVEYELVRDFKDKYLEEAFSNFQSSKD
KFEQEYNNFIAQNAWVKNYAIFKAFRKANNYQAWNFWSLEYKNWIKDKAIELNQFQNEID
YQIFLQFIFYKQWFDLREYANQNNIEIMGDLPIYLGFDSADVWEHQDIFLLDENQNPSFV
AGVPPDFFSETGQLWGNPLYDWDKLKETNFEFWIERLKGNFRLFDIVRIDHFRAFDTYWK
IPAGEKTAINGEWIEAPGYDFFDTVYKRIPDANIIAEDLGDLRPEVLELRDHYKLKGMKV
FPFHFDFKTAKFVEDSNIIAYSGTHDNNTLKGWYFDELNRYQRKLLKKYFKANDRNIFRK
IIKYLLNCDAEYVILPVQDILELGREARLNTPGTVGSPNWQWKLSDFDLLRTEV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatctggattattattagctatctcaagtttaccaagtcaatttggcattggt
gacttgggtaaaagcgcttatgaatttgttgatatcctaaaacaagcaaatactaagatt
tggcaggtattaccacttacaccactaggttttggtaattcaccatatcagtcaagctct
tcttttgcaggtgatgaaatctatattagcttagaaaaactagcagattatggtttgctt
gaagaatcatctcttaaaagtctgaatgtaaactctgacaaagttgaatatgaacttgtt
cgtgatttcaaagataagtatctcgaagaggcatttagtaattttcaaagctcaaaagat
aagtttgaacaagaatataataattttatagctcaaaacgcttgggttaaaaattatgct
atttttaaagcttttagaaaggctaataattaccaagcttggaatttttggtcgctagaa
tataaaaactggatcaaagataaagctatagaacttaatcaatttcaaaacgagatagat
tatcaaatatttttacagtttatcttttataagcagtggtttgatctaagggaatacgct
aatcaaaataatattgaaataatgggtgatttacctatttatttaggttttgactctgcc
gatgtttgggagcatcaagatatatttctattagacgagaatcaaaatcctagtttcgtt
gcaggtgttccacctgactttttctcagaaactggtcagctatggggtaatcctctatat
gattgggataagctcaaagaaacaaattttgaattttggattgagcgcttaaagggtaac
ttcaggctatttgatatcgttaggattgatcattttagagcttttgatacatattggaag
ataccagcaggtgaaaagactgctataaatggtgagtggatcgaggctcctggttatgat
ttctttgatacagtttataagcgtattccagatgctaatattattgcagaagatttaggt
gatttacgccctgaagtacttgagttgcgtgatcactacaagctaaaaggcatgaaagta
tttccttttcattttgattttaaaacagctaagtttgttgaagatagtaatatcattgca
tactcaggtactcacgataataatactctcaaaggatggtattttgatgagttaaataga
tatcaaagaaagctgttaaagaaatattttaaagctaatgatagaaatatttttagaaag
attattaagtatttactaaattgtgatgctgaatatgtaatcctgccagtacaagatatt
ttagaattaggtcgtgaggctagactaaatactccagggacagttggttcaccaaattgg
cagtggaagttgtctgattttgacttattaagaacagaagtttag

DBGET integrated database retrieval system