KEGG   Francisella philomiragia: Fphi_0328Help
Entry
Fphi_0328         CDS       T00652                                 

Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fph  Francisella philomiragia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Fphi_0328
Enzymes [BR:fph01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Fphi_0328
Exosome [BR:fph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Fphi_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
355747..357669
Genome map
AA seq 640 aa AA seqDB search
MKNVNSKQNNHSTIGEQDIHFFHEGKHIYAYEFMGAHKASEDGIDGIRFTTWAPNAKSIC
VIGDFNHWQVEDKNHMKRITDAGLWSVFIADVKDGDKYKFVVTNKDTNHYVYKSDPYAFF
SELRPNTASVISTQTTYKWHDEKWLKKRATADYYNSPMNTYELHLASWKTKDDRFMTYEE
IAEVLPKYVKDMGYTHVEFMPLHEHPLDASWGYQPTGFYSINSRHGDLVGLKHLVDKLHT
HDIGVILDWVPGHFCKDQHGLINFDGSACYEYQEPTKAINKGWGTHNFDLGRNEVKCFLI
SNAMYWINEFHIDGLRVDAVSNILYLNYDREDGQWVPNIHGGHENLEGIAFLRELNGVLK
HTCKGVITIAEESSSWPNISTPVEQGGLGFDFKWNMGWMNDTLRYISLDPVYRKYHHNLI
TFSMVYHYSEKFILSISHDEVVHGKKSLINKMWGDLWNKYAGLRLYMSFMIGHPGKKLIF
MGSEFGQFIEWREYEQLQWQVVDEYHTHRETLNFFKKLNEFYKAETALWECDYDHKGFQW
IDANNSEQSILSFVRSNKDGKEKLIFVCNFTPVTYYDYHIGVPDAGSYIEAFNSDDLEFG
GSGQLIADEIFSTPESSHGFDQRITIKVPPMATLVLKLKK
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgtaaattcaaaacaaaataatcactctactattggcgagcaagatattcat
ttcttccacgaaggtaagcacatatatgcttatgagttcatgggtgctcacaaagcatct
gaagatggaattgatggtattagatttacaacatgggctccaaatgcaaaaagtatttgt
gtcattggtgattttaaccactggcaagttgaagataaaaatcacatgaaacgtatcact
gatgctggactatggagcgtatttatcgcagatgtaaaagatggtgataaatataaattt
gtagtcacaaataaagatacaaatcattatgtatataaaagtgatccttatgcttttttc
tcagaattaagaccaaacacagcctctgtaataagtacgcaaaccacttataaatggcac
gatgagaaatggttaaaaaagcgtgctactgccgactactataatagcccaatgaacacc
tacgaacttcacttagcatcatggaaaactaaagatgataggtttatgacttatgaagag
attgctgaagtattaccaaaatatgtcaaggatatgggatacacacatgttgagtttatg
ccgttacatgagcatccactagatgcttcgtggggttatcaaccaacaggtttttactca
attaatagtcgtcacggtgatttagtaggtttgaagcacctagttgataaacttcacact
catgatattggtgtaatcctagattgggtaccgggacacttttgtaaagatcaacatggc
ttaatcaactttgacggtagtgcatgttacgaataccaagagcctacaaaagctataaat
aaaggttggggaacgcataattttgatctaggtagaaatgaggtcaaatgtttcttaata
tcaaatgccatgtactggatcaatgaatttcatatcgatggacttcgtgtagatgcagta
tcgaatatcttatacctaaactatgatagagaagatggtcagtgggtacctaacattcat
ggtggacatgaaaatttagaaggtattgctttcttaagagagctcaatggtgtcttaaaa
catacttgcaaaggagtaatcacaattgctgaagaatcatcatcttggccaaatatatcc
acacctgttgaacaaggtgggttaggatttgatttcaaatggaacatgggttggatgaac
gatacactacgctatatttcattagaccctgtctatcgcaaatatcatcacaacttaatt
actttctctatggtataccactattcagagaaatttattttgtctatatctcatgatgaa
gttgtacatggtaagaagtcattgataaataaaatgtggggcgatctgtggaataagtat
gctggacttcgtttatatatgtcatttatgattggacatcccggtaaaaaactcatattt
atgggtagtgaatttggtcaatttatcgaatggcgagagtatgaacaactacaatggcaa
gttgttgatgaatatcatacgcatagagaaacattaaatttctttaagaaactaaatgaa
ttctataaagctgaaactgcactatgggaatgtgattatgatcataaaggcttccagtgg
attgatgcaaacaactctgaacaaagtattttgtcttttgttagatcaaacaaggatggt
aaagaaaagctaatatttgtctgtaacttcactccggtgacatattacgactaccacata
ggtgttcctgatgcaggatcttatattgaagcatttaactctgatgatcttgaatttggt
ggctctggtcaacttattgccgatgaaatattttcaactcctgaatcatcgcatggtttt
gaccaaaggattacaataaaagtccctccaatggccactcttgttctcaaactcaaaaaa
taa

DBGET integrated database retrieval system