KEGG   Francisella philomiragia: Fphi_0600Help
Entry
Fphi_0600         CDS       T00652                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fph  Francisella philomiragia
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fphi_0600
   00670 One carbon pool by folate
    Fphi_0600
Enzymes [BR:fph01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Fphi_0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
632740..633237
Genome map
AA seq 165 aa AA seqDB search
MISLIVAYDKNLGIGKENTLAWKLSEDLKNFKKITENNYIVMGRKTFESIGRPLPNRKNI
ILTRDKDYKQDKCLIINSVQEILNFAQSKPHYEIFIIGGAQIYKEFLQYADRLYITEVDT
EMSDLDAFFPMWDKSKYKRIGHKQFKKDDKNEFDFTFAVYEKASI
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgatttcattaatagttgcttatgacaaaaatctaggtataggtaaagaaaatactcta
gcatggaaactttctgaagacctgaaaaacttcaaaaagataaccgagaataattatatt
gtaatgggtagaaaaacttttgagtcaatcggtcgccctctgccaaaccgtaaaaacatt
atcttaactagagataaagattataagcaggataagtgtttaataattaacagtgttcaa
gaaattctaaacttcgcgcaatcaaaacctcattatgagatttttataattggtggtgcc
cagatttataaagaatttttacaatatgccgatagactatacataactgaagtcgataca
gaaatgagtgatcttgatgctttctttcctatgtgggacaaatctaaatacaaacgcata
ggccataaacaattcaaaaaagatgataaaaacgagtttgacttcacgtttgccgtatat
gaaaaagcctctatttaa

DBGET integrated database retrieval system