KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_0618Help
Entry
Fphi_0618         CDS       T00652                                 

Definition
(GenBank) DNA polymerase III (CHI subunit) protein
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
fph00230  Purine metabolism
fph00240  Pyrimidine metabolism
fph01100  Metabolic pathways
fph03030  DNA replication
fph03430  Mismatch repair
fph03440  Homologous recombination
Module
fph_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Fphi_0618
   00240 Pyrimidine metabolism
    Fphi_0618
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Fphi_0618
   03430 Mismatch repair
    Fphi_0618
   03440 Homologous recombination
    Fphi_0618
Enzymes [BR:fph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Fphi_0618
DNA replication proteins [BR:fph03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Fphi_0618
DNA repair and recombination proteins [BR:fph03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Fphi_0618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ABZ86837
JGI: Fphi_0618
UniProt: B0U121
Position
complement(653927..654364)
Genome map
AA seq 145 aa AA seqDB search
MKVEFRVLQTPDINQMLEVLIDTVIKEYDECKTIAILAPTGIAKQLDDDLWQDGQDSFIP
HHCAIAAREYNQYKNIPILITDNLFITSGYDVLINIMEVAVDPQRVKIKELKEFVYQEDR
ALQASRKKYVYYKNSNLEITTTKDS
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagagtttagagttttacaaacgccagatattaaccaaatgctagaagtgttg
attgatacagttatcaaagaatatgatgaatgcaaaacaatagcgattcttgctcctaca
ggtattgcaaaacagcttgatgatgatttatggcaagatggtcaggattcttttatacca
catcattgtgctatagctgctagagaatataaccaatataaaaatattccgattcttatc
acagataatttatttatcacttcaggttatgatgttttgattaatatcatggaagtagca
gttgatcctcagcgagttaagatcaaagagttaaaagagtttgtttatcaggaagataga
gctttgcaggcttcgcgtaagaagtatgtttactataagaactcaaatttagaaataact
actaccaaagatagttag

DBGET integrated database retrieval system