KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_0618Help
Entry
Fphi_0618         CDS       T00652                                 

Definition
(RefSeq) DNA polymerase III (chi subunit) protein
  KO
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Fphi_0618
   00240 Pyrimidine metabolism
    Fphi_0618
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Fphi_0618
   03430 Mismatch repair
    Fphi_0618
   03440 Homologous recombination
    Fphi_0618
Enzymes [BR:fph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Fphi_0618
DNA replication proteins [BR:fph03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Fphi_0618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(653927..654364)
Genome map
AA seq 145 aa AA seqDB search
MKVEFRVLQTPDINQMLEVLIDTVIKEYDECKTIAILAPTGIAKQLDDDLWQDGQDSFIP
HHCAIAAREYNQYKNIPILITDNLFITSGYDVLINIMEVAVDPQRVKIKELKEFVYQEDR
ALQASRKKYVYYKNSNLEITTTKDS
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagagtttagagttttacaaacgccagatattaaccaaatgctagaagtgttg
attgatacagttatcaaagaatatgatgaatgcaaaacaatagcgattcttgctcctaca
ggtattgcaaaacagcttgatgatgatttatggcaagatggtcaggattcttttatacca
catcattgtgctatagctgctagagaatataaccaatataaaaatattccgattcttatc
acagataatttatttatcacttcaggttatgatgttttgattaatatcatggaagtagca
gttgatcctcagcgagttaagatcaaagagttaaaagagtttgtttatcaggaagataga
gctttgcaggcttcgcgtaagaagtatgtttactataagaactcaaatttagaaataact
actaccaaagatagttag

DBGET integrated database retrieval system