KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_0834Help
Entry
Fphi_0834         CDS       T00652                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase, Phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
  KO
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fphi_0834
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fphi_0834
Enzymes [BR:fph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Fphi_0834
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Fphi_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(887595..888956)
Genome map
AA seq 453 aa AA seqDB search
METILAKIVEAKRNWLFAKKRLFPLDVFKKEVIKTDRDFYQALESDKAVFILECKKGSPS
KGVIRKKFDLNEIAAVYKNYANVISVLTDEEFFMGSFANLEIVRKQVTQPILCKDFIIDE
YQIYLARHYQADAVLLMLSVLDDNEYKKLAKVANRLGMGILTEVSNEEELERAIKLKAKV
IGINNRNLRDLSIDLNTTRLLAPKIPKGIIIISESGIYKNQEIRDLRNYVNGFLIGSSIM
SERNLEIAVRKLVYGFNKVCGLTSVENAQKAYNAGAVYGGFIFVEKSPRCVDFAMAKQIT
KKVRLNYVGVFVNASIEDVVNTAYGLKLSAVQLHGDENQEYIDALKSKLHRNCQIWKAYG
IDKTVPEFFANVDYHLLDAQVDGKSGGTGKAFDWSLIKDRKNIILAGGLNAKNIAKAIEL
RCSAYDINSGVESEPGQKDQQKLKEVFEVIRDY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatattagctaagatagttgaagcaaaaagaaattggctttttgcaaaaaaa
agattatttccactagatgtattcaaaaaagaagttataaaaacagatagagatttttat
caggctttagaatcagacaaagcagtatttattctagagtgtaaaaaaggatctccttct
aaaggagttatccgtaaaaaatttgatctaaatgaaatagcagcagtatataaaaattac
gcaaatgtaatatctgtacttacagatgaagaattttttatgggtagctttgcaaatcta
gagattgttagaaagcaagtaactcaacctatactttgtaaagattttattatagatgag
tatcaaatatatttagctaggcattatcaagctgatgcagtgttactgatgctttcggta
ttagatgataatgagtataagaaactagcaaaagtagctaatcgtctaggcatgggtatc
ttaactgaagttagtaatgaagaagaacttgaaagagctatcaaactcaaagcaaaagtt
ataggtattaataatcgtaatctaagagatctttctatagatctaaatactacgcgtctt
ttggcgccaaaaatacctaaaggaataattattatttcagaatcaggaatttataaaaat
caagaaatccgtgatttaagaaattatgttaatggctttttgataggtagttctattatg
agtgaacgcaatctagaaattgcagttagaaagcttgtatatggttttaataaggtttgt
ggtcttacctctgtagaaaatgcgcaaaaagcatataatgcaggagcggtatatggaggg
tttatatttgtagagaaatctcctcgctgtgtagattttgccatggcaaaacaaataact
aaaaaagttagattaaactatgtgggcgtatttgttaatgccagtattgaagatgttgta
aatactgcctatggtttgaaacttagtgcagtgcagttgcatggtgacgaaaatcaagaa
tatatagatgcactaaaatcaaaactacatagaaactgtcagatatggaaagcttatgga
attgacaaaactgtcccagagttttttgctaatgtagattatcacttattagatgctcaa
gtagatggtaaatcaggtggtactggtaaagcttttgattggagtcttatcaaagatagg
aaaaatataatacttgctggtggtctgaatgctaaaaatatagcaaaagcaatagaacta
agatgttctgcttatgatattaattctggtgtagaatctgagccaggacaaaaagatcag
cagaagttaaaagaagtttttgaggttataagagactactag

DBGET integrated database retrieval system