KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_0866Help
Entry
Fphi_0866         CDS       T00652                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fphi_0866 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fphi_0866 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fphi_0866 (trpA)
Enzymes [BR:fph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Fphi_0866 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(922730..923539)
Genome map
AA seq 269 aa AA seqDB search
MDRYTTLFASLEKRSEGAFIPFVTIGDPNKELSLEIIDTLVSSGADALELGIPFSDPLAD
GPTIQEANIRALESGVTPKDCFDILTKIRVKYPHIPIGLLLYANLVYANGIENFYQKCLA
AGVDSILIADVPAHESKEFRDIAKRVGISQIFIAPPDANEATLKQISELGSGYTYLLSRV
GVTGAETAANMPVEDVLAKLREYNAPKPILGFGISKPEQVQQAIKAGAAGAISGSATVKI
IQNNLSNKETMLSELECFVKEMKAATKNN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggatagatacacaaccctttttgcaagtttagagaaaagaagtgaaggtgcttttata
ccttttgtaacaattggagacccgaataaagaactatctcttgaaattatcgatactcta
gttagctcaggtgctgatgctcttgagttaggtatacctttttctgatcctttagcagat
ggaccaacaattcaagaagcaaatattcgtgccctagagagtggcgtaactcctaaagat
tgttttgatatcctcacaaaaataagagtaaaataccctcatatccccattggcttattg
ctttatgctaatttagtttatgcaaatggtatagagaatttttatcaaaaatgtttagct
gcaggtgttgattctatacttatagctgatgtaccagctcatgaatctaaagagtttcgt
gatattgctaaaagagtaggtatttctcagatattcattgctccgcctgatgctaatgag
gctactcttaaacaaatttctgaacttggaagtggttatacttacttgctttcaagagtt
ggcgtaacaggtgcagaaactgcagcaaatatgcccgtagaagatgtgttagctaaactt
agagaatataatgcacccaagccaatcttaggttttggtatctctaaacctgagcaagta
caacaagctatcaaagcaggtgctgctggtgcaatttcaggttctgcaacagtaaaaata
attcaaaacaatctctcaaataaagagacaatgcttagtgaacttgaatgtttcgttaaa
gaaatgaaagccgcaactaaaaataattaa

DBGET integrated database retrieval system