KEGG   Francisella philomiragia: Fphi_0900Help
Entry
Fphi_0900         CDS       T00652                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fph  Francisella philomiragia
Brite
Enzymes [BR:fph01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Fphi_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
966235..966855
Genome map
AA seq 206 aa AA seqDB search
MNFELARENMVKQQVLTEGLSLDGVAKIMADIPREIFLPKEYQSLAYCDTNLVIGDRELR
SPMFTARLIEALAMKKTDNVLKLGLETGYPVALIAKLCNSVELVDYDEERLAIARRNLAK
VDVYNVEFNSAEHLTNIIKNAKKYNCIYISNVVEENEVDESLLNLLEVGGRLVFVVRTDV
SDKAYLITKAVKETYQKNFLFNVYNR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgagcttgctagagagaatatggtaaagcaacaagtcctcactgaaggtctt
tctttagatggtgttgcaaagattatggcagatatccctagagagatttttctacccaaa
gaatatcaatctttagcttattgtgatactaatcttgtgataggtgatagagagcttaga
agccctatgtttacagctaggctaatagaagctttagctatgaaaaaaactgataatgta
ttaaagcttggtttggagactgggtatccagtagctttgatagccaaattgtgtaacagt
gtagagcttgttgactacgacgaagaaagactggctatagctagacgcaatttagcaaaa
gtagatgtttataatgttgaatttaatagtgctgagcaccttacaaatattataaaaaat
gctaaaaaatataactgcatatacatatcaaatgttgtagaagaaaatgaagtagatgag
tctttactaaatcttcttgaggttggtggtagattggtttttgttgtcagaactgatgta
tctgacaaggcctatctcataactaaagcagtaaaagaaacatatcagaagaattttctc
tttaatgtttacaatagataa

DBGET integrated database retrieval system