KEGG   Francisella philomiragia: Fphi_0970Help
Entry
Fphi_0970         CDS       T00652                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
fph  Francisella philomiragia
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fphi_0970
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fphi_0970
   00650 Butanoate metabolism
    Fphi_0970
  Energy metabolism
   00190 Oxidative phosphorylation
    Fphi_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1046429..1046782
Genome map
AA seq 117 aa AA seqDB search
MAVISLTSSGIKDFFVQRVTAVIIAVYFGYLILETLCLSHAGTLNYDSWRGLFTDSMFFR
VATLMAYLAMFFHAWVGIWIICGDYIKYAWASALVMLSFVLIYVFCFFWLFAVLFFY
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaatttcattaacttcttctggaattaaagacttttttgttcaaagagtaaca
gctgtgattattgctgtttactttggttatctgattttggaaactttgtgtttatctcat
gctggaacacttaattatgacagttggagaggattgttcacagatagtatgttttttaga
gtcgctacactgatggcttatctagccatgtttttccatgcttgggttggtatttggatt
atttgtggtgactacattaagtatgcttgggcatcagctcttgttatgctgagctttgtg
ctaatttatgtgttctgctttttttggttattcgcagttttatttttctactaa

DBGET integrated database retrieval system