KEGG   Francisella philomiragia: Fphi_0974Help
Entry
Fphi_0974         CDS       T00652                                 

Definition
2-oxoglutarate dehydrogenase complex, E2 component, dihydrolipoyltranssuccinase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fph  Francisella philomiragia
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:fph01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:fph00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:fph00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1052168..1053628
Genome map
AA seq 486 aa AA seqDB search
MVELKVPMFPESVADGTLAQWNKSEGDFVEEGDIIAEIETDKVVMEVPATASGVLKGIKK
QEGDIVLSEEFLANIDTNASTSEPKQEVVVEASSQALGKEIDVKAPVFPESVADGTISEW
HKQEGDAVAEGDVLAEIETDKVVMEVPATSNGVLSKILKPAGETVLSSELIAKVIEGAVA
SAAPTSDAKIQTEDKGNDPHLVPSARKAFNASGLDSAASIEGTGKKGRITSEDVKKAVSS
SKPQQPAIVANQGPRYEKRVKMTRLRQTIANRLVEVQHTNAILTTFNEVDMSAVMALRNK
YKDIFLKEHDTKLGFMSFFIKAATEALKKFPDVNASIDGDEIVYHNYFDIGIAVGTDRGL
VVPVLRDTDGKSLAELEADVLDKAIKGRDGKLSLEDMQGGTFTITNGGTYGSMLSTPIIN
SPQSAILGMHNIVERPVVVNGEIKIRPIMYLALSYDHRIIDGGTSVRFLKMIKELLEDPN
RILLQV
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttgaattaaaagtacctatgtttccagagtctgttgcagatggcactctagctcag
tggaataaaagtgaaggcgattttgttgaagaaggtgatataatcgctgaaatagaaact
gataaagtagttatggaagttccagctactgcaagtggtgttcttaaaggaattaaaaag
caagaaggtgatatagttttatctgaagaatttttagcaaatattgatactaatgcttca
acttctgagccaaaacaagaggtcgttgtagaagcttcttcacaagctttgggtaaagaa
atagatgttaaagcacctgttttccctgagtctgttgcagatggtacgatttctgagtgg
cataagcaagaaggcgatgctgtagcagaaggcgatgtcttagctgagattgaaacagat
aaggttgttatggaagtccctgcaacatccaacggtgttttatcaaaaatattaaagcct
gcaggtgaaacagttctttcatcagagttaatagcaaaagttatagagggtgcagtggca
tctgcagcacctacgtcagatgcaaaaatacagactgaagataaaggcaatgatcctcat
ctagttccttctgcacgtaaagcttttaatgcaagtggattagattctgctgcaagtatt
gaaggtactggtaagaaaggacgtataacttctgaagatgttaaaaaggcggtatctagt
agcaagccacaacagcctgctatagtcgctaaccaaggtccaagatacgaaaaaagagtt
aagatgactcgtttacgtcagactattgcaaatagattagttgaggttcagcatactaat
gctatcttgacgacgtttaacgaggttgatatgagtgcagttatggcgcttagaaataaa
tataaagatatattccttaaagagcatgatacaaagcttggttttatgtctttctttatt
aaagcagcaactgaagcacttaaaaagttcccagatgttaatgcttctattgatggtgat
gagattgtttatcataactactttgatattggtatagctgttggtacagatagaggctta
gtggtacctgttttaagagatacagatggtaaatctttggcagagcttgaagcagatgtg
cttgataaagcaatcaaaggtcgcgatggtaaattaagtctagaagatatgcaaggtggt
acgtttacaattactaatggtggtacttatgggtctatgctatccacaccgattattaat
tcaccacaaagtgcgatcttgggtatgcacaatattgttgaaagacctgtagtagtaaac
ggcgagatcaaaatccgtccaataatgtatttggcattatcttatgatcatagaattatc
gatggtggtacatcagtaagattcttgaagatgattaaagaattgttagaagatccaaat
agaatccttctacaagtataa

DBGET integrated database retrieval system