KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_0974Help
Entry
Fphi_0974         CDS       T00652                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex, E2 component, dihydrolipoyltranssuccinase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
fph00020  Citrate cycle (TCA cycle)
fph00310  Lysine degradation
fph01100  Metabolic pathways
fph01110  Biosynthesis of secondary metabolites
fph01120  Microbial metabolism in diverse environments
fph01130  Biosynthesis of antibiotics
fph01200  Carbon metabolism
Module
fph_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fph_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fphi_0974
  Amino acid metabolism
   00310 Lysine degradation
    Fphi_0974
Enzymes [BR:fph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Fphi_0974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 E3_binding GCV_H QRPTase_N T2SSB HlyD_D23 RE_HindIII
Motif
Other DBs
NCBI-ProteinID: ABZ87197
JGI: Fphi_0974
UniProt: B0TWT9
Position
1052168..1053628
Genome map
AA seq 486 aa AA seqDB search
MVELKVPMFPESVADGTLAQWNKSEGDFVEEGDIIAEIETDKVVMEVPATASGVLKGIKK
QEGDIVLSEEFLANIDTNASTSEPKQEVVVEASSQALGKEIDVKAPVFPESVADGTISEW
HKQEGDAVAEGDVLAEIETDKVVMEVPATSNGVLSKILKPAGETVLSSELIAKVIEGAVA
SAAPTSDAKIQTEDKGNDPHLVPSARKAFNASGLDSAASIEGTGKKGRITSEDVKKAVSS
SKPQQPAIVANQGPRYEKRVKMTRLRQTIANRLVEVQHTNAILTTFNEVDMSAVMALRNK
YKDIFLKEHDTKLGFMSFFIKAATEALKKFPDVNASIDGDEIVYHNYFDIGIAVGTDRGL
VVPVLRDTDGKSLAELEADVLDKAIKGRDGKLSLEDMQGGTFTITNGGTYGSMLSTPIIN
SPQSAILGMHNIVERPVVVNGEIKIRPIMYLALSYDHRIIDGGTSVRFLKMIKELLEDPN
RILLQV
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttgaattaaaagtacctatgtttccagagtctgttgcagatggcactctagctcag
tggaataaaagtgaaggcgattttgttgaagaaggtgatataatcgctgaaatagaaact
gataaagtagttatggaagttccagctactgcaagtggtgttcttaaaggaattaaaaag
caagaaggtgatatagttttatctgaagaatttttagcaaatattgatactaatgcttca
acttctgagccaaaacaagaggtcgttgtagaagcttcttcacaagctttgggtaaagaa
atagatgttaaagcacctgttttccctgagtctgttgcagatggtacgatttctgagtgg
cataagcaagaaggcgatgctgtagcagaaggcgatgtcttagctgagattgaaacagat
aaggttgttatggaagtccctgcaacatccaacggtgttttatcaaaaatattaaagcct
gcaggtgaaacagttctttcatcagagttaatagcaaaagttatagagggtgcagtggca
tctgcagcacctacgtcagatgcaaaaatacagactgaagataaaggcaatgatcctcat
ctagttccttctgcacgtaaagcttttaatgcaagtggattagattctgctgcaagtatt
gaaggtactggtaagaaaggacgtataacttctgaagatgttaaaaaggcggtatctagt
agcaagccacaacagcctgctatagtcgctaaccaaggtccaagatacgaaaaaagagtt
aagatgactcgtttacgtcagactattgcaaatagattagttgaggttcagcatactaat
gctatcttgacgacgtttaacgaggttgatatgagtgcagttatggcgcttagaaataaa
tataaagatatattccttaaagagcatgatacaaagcttggttttatgtctttctttatt
aaagcagcaactgaagcacttaaaaagttcccagatgttaatgcttctattgatggtgat
gagattgtttatcataactactttgatattggtatagctgttggtacagatagaggctta
gtggtacctgttttaagagatacagatggtaaatctttggcagagcttgaagcagatgtg
cttgataaagcaatcaaaggtcgcgatggtaaattaagtctagaagatatgcaaggtggt
acgtttacaattactaatggtggtacttatgggtctatgctatccacaccgattattaat
tcaccacaaagtgcgatcttgggtatgcacaatattgttgaaagacctgtagtagtaaac
ggcgagatcaaaatccgtccaataatgtatttggcattatcttatgatcatagaattatc
gatggtggtacatcagtaagattcttgaagatgattaaagaattgttagaagatccaaat
agaatccttctacaagtataa

DBGET integrated database retrieval system