KEGG   Francisella philomiragia: Fphi_0977Help
Entry
Fphi_0977         CDS       T00652                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fph  Francisella philomiragia
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fphi_0977
   01230 Biosynthesis of amino acids
    Fphi_0977
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fphi_0977
   00051 Fructose and mannose metabolism
    Fphi_0977
   00562 Inositol phosphate metabolism
    Fphi_0977
Enzymes [BR:fph01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Fphi_0977
Exosome [BR:fph04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Fphi_0977
  Exosomal proteins of bladder cancer cells
   Fphi_0977
  Exosomal proteins of melanoma cells
   Fphi_0977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1055537..1056298
Genome map
AA seq 253 aa AA seqDB search
MQKLIMGNWKMNGSSASIKELCKGISEVNYNSEKVAVAVFPSSVYVKEVLAQLPKEIGVG
LQNITFYDNGAYTGELSAEMLHDVGCNYLLIGHSERRSLFGETDQDVFKKLNKIIDTSVV
PVVCIGESLEDRQGGRLEKVLTTQLSLILENLSIEQLARVIIAYEPVWAIGTGVVASLEQ
VQETHQFIRSLVAKVDENLAKNMKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKASEF
NEIINQANKICTE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaataatgggaaattggaaaatgaatggcagctctgcaagcataaaagag
ctttgcaagggtatttctgaagtcaattacaatagtgagaaagttgctgtggctgttttc
ccttcaagtgtatatgttaaagaggtacttgcacagcttcctaaggaaattggtgtaggt
ctgcagaatattactttttatgataatggtgcatatactggagagttatctgcagagatg
ttacatgatgttggttgtaattatctacttataggacattctgaaagaagatctttattt
ggtgagactgatcaagatgttttcaaaaagcttaataaaattatagatacatctgttgtg
ccagttgtatgtataggagagtctttagaagacagacaaggcggaaggttagaaaaagta
ctaacaacacaattaagtctaatattagaaaatttgtctattgagcaacttgctagggtt
ataatagcttacgaacctgtttgggctataggtacaggagttgtagcatcattagagcaa
gtacaagaaacacatcaatttattcgttcgcttgtagctaaagtagatgaaaatcttgct
aaaaatatgaaaatagtgtatggtggtagcctaaaagctgaaaatgctaaagatatatta
agtttaccagatgttgatggtggcttgattggtggagcatctttgaaagcttctgagttt
aacgaaataataaatcaagcaaataaaatatgtacggaataa

DBGET integrated database retrieval system