KEGG   Francisella philomiragia: Fphi_1033Help
Entry
Fphi_1033         CDS       T00652                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fph  Francisella philomiragia
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Fphi_1033
Enzymes [BR:fph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Fphi_1033
Exosome [BR:fph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Fphi_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1118604..1120103
Genome map
AA seq 499 aa AA seqDB search
MSKQFILAIDQGTTSSRAIIFDKKGNIKKIAQKEFTQIYPKSGWVEHDPMEIWASQSSIV
REALEYARVSPRDIAAIGITNQRETTVVWDKNTGQPVYNAIVWQCRRTSHICDEINKNED
LKKYIRKNTGLIVDAYFSATKIKWILDNVDGAREKAEKGDLLFGTIDTWLIWNLTKGEVH
ATDFSNASRTMLFNINTLEWDKKILEYLDIPVSMLPEVRSSSGDFGHTHPSTLGGARIPI
AGVAGDQQSALFGHCCFEEGMAKNTYGTGCFALMNVGDKPVFSDAGLLTTIAWAEDGKPT
YALEGSVFIAGAVIQWIRDGLGLVRSAEDSEYYATKIDSTDGVYLVPAFVGLGTPYWDMY
ARGTIVGITRDTRREHIIRAALEAIAYQAKDVLDCMKEDTGLDWAGLRVDGGAVQNNFLM
QFQSDILQSEISKPKINEITGLGAVFLAGLAVGFWKDKEELKTILTTEKTFEPKKDPETV
AHDYKGWKKAVQRSMAWAE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcaatttatattagcaatagatcaaggtactactagttcacgagcaataatt
tttgataaaaaaggcaatatcaaaaaaatagcacaaaaagaatttacacaaatttatcca
aaaagtggttgggtagagcatgatccaatggaaatatgggcatcacaaagtagtattgtt
agagaagctcttgagtatgctagagtttctcctagggatatagcagcgattggtattact
aatcaaagagaaacgacggtagtttgggataaaaacacaggtcaaccagtatataatgct
atagtgtggcagtgtcgtagaacatcgcatatttgtgatgaaattaacaagaatgaagat
cttaaaaaatatatccgtaaaaacacaggtcttattgttgatgcgtatttctctgctaca
aaaatcaaatggattttagacaatgttgacggagctagagaaaaagcagaaaaaggagat
ttactttttggaacaattgatacttggttaatctggaatttaactaagggtgaagttcac
gctactgacttttcaaatgcttcaaggacaatgttgttcaatatcaatacacttgaatgg
gacaaaaaaattctagagtatttagatattccagtatcaatgttgccagaggttagatct
tcgagtggtgattttggacatacacaccctagcactctaggaggtgcacgaattccaata
gcaggagttgctggagatcagcagtcagcattgtttggacactgctgttttgaagaagga
atggcaaaaaatacttatggtacgggatgctttgctctaatgaatgtgggtgacaagcct
gtattttctgatgctggtttactgactacaatcgcttgggctgaggatggtaaaccaacc
tatgctttagaggggagtgtctttattgccggagcagttatccaatggattagagatggt
ctaggtcttgtacgttctgctgaagatagtgaatattacgcaacaaaaattgactcaact
gatggtgtgtacttggtgccggcatttgttggacttggtacgccatattgggatatgtat
gctcgtgggactattgttggtatcactcgagatactagacgtgagcatattattagagca
gctcttgaggctatagcttatcaagcaaaggatgttttagattgtatgaaagaagatacc
ggtcttgattgggcaggtcttcgtgtcgatggtggcgcagtgcaaaataatttcttgatg
caattccaatcagatatcttacaatcagaaatttctaagcctaaaattaatgagattaca
ggtttaggtgcggtattcttagcaggtctagctgtagggttctggaaagataaagaagaa
cttaagactattcttacaacagaaaaaacttttgagccgaaaaaagatcctgaaactgta
gcgcatgattacaaaggctggaaaaaagcagttcaaagaagtatggcttgggctgaataa

DBGET integrated database retrieval system