KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_1186Help
Entry
Fphi_1186         CDS       T00652                                 

Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
fph00010  Glycolysis / Gluconeogenesis
fph00020  Citrate cycle (TCA cycle)
fph00620  Pyruvate metabolism
fph01100  Metabolic pathways
fph01110  Biosynthesis of secondary metabolites
fph01120  Microbial metabolism in diverse environments
fph01130  Biosynthesis of antibiotics
fph01200  Carbon metabolism
Module
fph_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fphi_1186
   00020 Citrate cycle (TCA cycle)
    Fphi_1186
   00620 Pyruvate metabolism
    Fphi_1186
Enzymes [BR:fph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Fphi_1186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 HlyD_3 DUF2118 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABZ87411
JGI: Fphi_1186
UniProt: B0TXF3
Position
1293231..1295102
Genome map
AA seq 623 aa AA seqDB search
MSIEIVKVPDIGDYDSVDVIEVNVAEGDVIAEEDSLITLETDKASMEVPSPIAGKIVKLT
VKVGDKVSQGTAIMEVEVAGDETAAEPKQEAAPAQQQQATAIVDVEVPDIGDYDSVDVIE
VSVAVGDEIAEEDSLITLETDKASMEVPSPVAGKVVEIITKVGDKVSQGSLILKVETGAS
ASAATQAPAQQVAPAQSATEEVVDVKVPDIGDYDSVDVIEVSVAVGDEIAEEDSLITLET
DKASMEVPSPVAGEVVEIITKVGDKVSQGSLILKVKTKGTAPVAAPSQPAKQEAPKQESQ
PAVPALATQTNVNEYAVDNSKAHASPAVRKLARVLNVDLSKVKATGRKGRVTKEDCYNYI
KHAVTQVQTGKVAASGSGLDLLDDPVVDFAKFGEIETQPLTRINKISAKNLHRNWVKIPH
VTFYDDADVTDLEEFRKSKKAFSEKTGVKITPLSFLVKAAAVALQEFPRMNSSLSNDGEN
LILKKYYNIGFAADTPSGLMVPVIKDADKKGIIEISKDIMELAGKARDGKLGAKDMTGAT
FTISSIGVLGTTAFTPIINMPEVAIMGVSKTAVKPVWNGKEFEPRTMLPLSMSADHRVID
GALAAKFLTRYCQILSDLREIIM
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagagatagttaaagttcctgatatcggggattatgatagtgtagatgtgatc
gaagttaatgttgctgaaggtgatgttatcgctgaagaagactctttgattactttagaa
acagacaaggctagtatggaggttccatctcctatagctggtaagattgttaagttgact
gtaaaagttggcgacaaagtttcgcaaggtactgctattatggaagttgaggttgcaggt
gatgaaacagcagctgaacctaagcaagaagctgctccagcgcaacaacagcaagctaca
gcaatagttgatgtagaagttccagatattggtgactatgatagtgttgatgttatcgaa
gtgtctgtagctgttggtgatgagattgctgaagaagattctttgattacattagaaaca
gataaagctagtatggaagtaccatctcctgttgccggaaaagttgttgagattatcaca
aaagttggtgataaggtttcgcaaggtagcttgatattaaaagttgagactggagcaagc
gcttcagcagctacacaagcgccagcacagcaagttgcacctgcgcagtcagctactgaa
gaagttgtagatgtcaaagttccggatattggtgattatgatagtgttgatgttatcgag
gtatcagtagctgttggtgatgagattgctgaagaagattctttgattacattagaaaca
gataaggctagtatggaggttccgtctccagtagctggtgaagttgttgagattatcaca
aaggttggtgataaagtttcgcaaggtagcttaattcttaaggtcaagacaaagggcaca
gctcctgtagcggcacctagtcagccagcaaagcaagaagctcctaagcaagagtctcag
ccagcagtacctgctttagcgactcaaactaatgttaatgaatatgccgtagataattca
aaagctcatgcttctccagctgttagaaagctagctagagttttaaatgttgatttgagc
aaggtcaaagctacagggcgtaaaggacgtgtaacaaaagaagattgttataactacatc
aagcacgctgtaacacaagttcagactggtaaagttgctgctagtggtagtggtttagat
cttctagatgatccagtggtagacttcgctaagtttggtgagattgaaactcaaccattg
actcgtatcaacaaaattagtgcaaaaaatctacatagaaactgggttaaaattccacat
gttactttctatgatgatgcagatgttactgatctggaagagtttaggaagtctaaaaaa
gcattttctgagaaaactggagttaagattacgccattatcattcttggtcaaagctgct
gctgtagcacttcaagagttcccgagaatgaatagttcgctatcaaatgatggtgaaaac
ttgatattgaagaaatactacaatattggctttgctgctgatactccatctggtctaatg
gttccagttatcaaggatgctgacaaaaaaggtattattgaaatatcaaaagatattatg
gaattagctggtaaagcgcgtgatggtaaattaggtgccaaagatatgactggggctaca
tttactatctctagtataggtgtgcttgggactacagcatttacaccaattattaatatg
ccagaagtagcgattatgggtgtatctaagactgctgttaagccagtgtggaatggtaaa
gaatttgaacctagaacaatgctacctctgtctatgtcagcagatcatagagtaattgat
ggtgcattagctgctaagttcttaactagatattgtcagattttatctgatttacgtgaa
atcataatgtaa

DBGET integrated database retrieval system