KEGG   Francisella philomiragia: Fphi_1195Help
Entry
Fphi_1195         CDS       T00652                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
fph  Francisella philomiragia
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Fphi_1195
Enzymes [BR:fph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Fphi_1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1304074..1305228
Genome map
AA seq 384 aa AA seqDB search
MLKKTITILGATGSIGDSTLAVIRESNDFEVYALSAFSNVEKLAKLCKEFSPKFAVVPDL
VKKQQLQTLVSDVTVLVGEDALEEVSSASEVDIVMSAIVGIAGLKPTFAAARAGKKILLA
NKESLVTAGHLLIEEVEKNNAQLIPVDSEHNAIFQCIDNSSKKYTKEIDEIVLTASGGPF
RDKELSELIDVTPAQACAHPNWQMGRKISVDSSTMVNKALEVIEAYWLFSVSADKIGVLI
HPQSVIHSMVKYVDGSYIAQLGVPDMRTPIANSMYYPNRGSVSVDRLDFTKYELTFREAC
FERFEALKIVFDNLSNKNYAANIVFNAANEVLVAAFLNEKIKYLDIIEVNKKVTKELIFE
NPASIEEVFEIDKKTREYVDSILG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagaaaacgataactatattaggagctacaggctcaattggagatagtacacta
gctgtaattagagagagtaatgactttgaggtctatgccttatcagcttttagtaatgta
gaaaaattagcgaaattatgtaaagagttttcacctaaatttgctgtagttccagatttg
gtcaaaaagcaacagttacaaactttagtatcagatgttactgttttagttggtgaagat
gccttagaagaagtttctagtgcttcagaagtagatatagtaatgtctgctatagttggt
atagcaggtcttaagcctacttttgctgcagctagagcaggcaagaaaattttgcttgcg
aataaggagtctcttgtaacagctggacatcttttaattgaagaagttgagaaaaataat
gctcagcttatacctgtagatagtgagcataacgctatatttcaatgtattgataactct
agtaagaaatatacaaaagaaatagacgaaatagttttgacagcatccggaggacctttt
agagataaagagttgagtgagttgatagatgtcacacctgctcaagcatgtgctcatcct
aactggcaaatggggcgaaaaatatcggttgattcatcaacaatggtaaataaagcacta
gaagttatcgaagcatattggcttttttctgtttcagctgataaaataggcgttctgatt
catccgcaaagtgtaattcactctatggttaagtatgtggatggtagctacatagcccag
ttgggtgtgcctgatatgaggactccaatagctaattcaatgtactatccaaatagagga
tcagtaagtgttgatagattagattttacaaaatatgagcttacttttagagaagcatgt
tttgaaagatttgaagctttaaaaatagtttttgataatttaagtaataaaaattatgca
gcgaatatagtttttaacgctgcaaacgaagttttagtagcagcattcttaaatgaaaaa
attaagtatttagatattatagaagtaaataaaaaagtaacaaaagagttaatttttgag
aatccagcaagtatagaagaagtttttgaaatagataaaaaaactcgagaatatgtggat
tctattttggggtaa

DBGET integrated database retrieval system