KEGG   Francisella philomiragia: Fphi_1214Help
Entry
Fphi_1214         CDS       T00652                                 

Definition
delta 9 acyl-lipid fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
fph  Francisella philomiragia
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Fphi_1214
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Fphi_1214
Enzymes [BR:fph01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Fphi_1214
Lipid biosynthesis proteins [BR:fph01004]
 Desaturase
  First
   Fphi_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1323736..1324566)
Genome map
AA seq 276 aa AA seqDB search
METQSNKVTIIAFAIMHIACLAIFFVNYNITALVVFLITFSARTFALTAGYHRYFAHKAF
QTSRVFQFILALVGTWASQKGPLWWSGHHRYHHIHSDKDTDLHSPKNGIFQSHVGWVFES
RSDHVDPKFTKDWVEYPELVWLDKYAHVSFALYLIGLFAIGSVINHFYPNLQTSGLAFVF
WGGILSTVLLYHTTFSVNSICHIFGKKDYETSDNSRNNWFIALVTFGEGWHNNHHKFAYS
VRNNLKAWQIDITYMILCVLKKFKIVWGFKEPKKTA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggaaactcaatcaaataaagtcactataatagcctttgctattatgcatattgcttgc
ttagcaatattttttgtaaattataatatcactgcactagttgtatttcttattacgttc
tcagctcggacattcgcattaacagctggttaccatcgttactttgcacacaaagctttt
cagacttctagagtatttcaatttattttagcattagttggaacttgggcatcccaaaaa
gggccgctttggtggtcaggtcatcatagatatcatcatatccattctgataaagataca
gatttacactctcctaagaatgggatcttccaatcacatgttggctgggtttttgaatct
agaagtgatcatgttgatcctaaatttaccaaagactgggtagaatatcctgagctagta
tggttagataagtatgctcatgtttcatttgcattatatctgataggtctctttgctatc
ggtagcgttattaatcacttctaccctaacctacaaacatcaggtttagcatttgtattt
tggggtggtattttaagtacagtattgttataccacactacatttagtgttaattcaatc
tgtcatatttttggtaaaaaagattatgaaacttcagataatagtcgcaataactggttt
atagcattagttacgtttggtgagggttggcataataatcaccataaatttgcttactct
gttagaaataatctcaaagcatggcagattgatattacatatatgattctttgtgttttg
aagaaattcaaaatagtatggggatttaaagaacctaaaaaaacggcttag

DBGET integrated database retrieval system