KEGG   Francisella philomiragia: Fphi_1231Help
Entry
Fphi_1231         CDS       T00652                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
fph  Francisella philomiragia
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fph01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:fph00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1339180..1340049
Genome map
AA seq 289 aa AA seqDB search
MKKVEAVGIAIGNAGREIGCGRAPYALLNELRDRRLDAQIINYIGGRAEVPTMGKYFTKV
AQTVSEILKEGKFPLALGGDHSCAIGTWSGVYDYLKSQKKELGLIWIDAHMDSHRPDTSE
TGNIHGMPVAHLLGYGHEELIKVLNDNPKLKPENIVFFGIRSYEKPEREFLEKLGVKVYY
QTDLTDRNFEELFLQEFERLEKVTEGNVGISFDLDGLDPTNLDAVGTPVENGIDPQVFYK
TIEKINFNSLVCFEVAEYNPLIDKTEISLKYMSKLIRLVEGNIKNLTQK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagaagcagtaggaatagctattggtaatgctggcagagaaattggttgc
ggaagagcaccatacgctttgttgaatgagttaagagatagacgtttagatgctcaaata
atcaattacattggcggaagagctgaagtacctactatgggtaaatattttactaaggtg
gctcagacggtatctgagattcttaaagaaggtaagtttcctttagctcttggaggagat
cactcatgtgcaataggtacatggagtggagtttatgattatcttaaaagtcagaaaaaa
gagcttggtttgatttggattgatgcgcatatggatagtcatagaccagacacttctgag
actggtaatatacatggtatgcctgtagcacatcttttaggatatggccatgaggaatta
ataaaggtactaaatgataatcctaagttaaagcctgaaaatattgtcttttttgggatt
cgctcttatgaaaagccagaaagagagtttttggaaaaattgggtgttaaagtttattat
caaactgatttaactgataggaactttgaagagttatttttacaagagtttgaacgtctt
gagaaggttacagagggtaatgtggggattagttttgacttagatggtttagatcctact
aaccttgatgctgtaggaactcctgttgaaaatggtattgacccacaagttttttacaaa
actattgagaaaattaattttaatagtttggtatgttttgaagtggcagaatacaatcct
ctgattgataaaacagaaatctcgcttaaatatatgtcaaaactaataagattagttgaa
ggtaatataaaaaatctaactcaaaaatag

DBGET integrated database retrieval system