KEGG   Francisella philomiragia: Fphi_1231Help
Entry
Fphi_1231         CDS       T00652                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
fph  Francisella philomiragia
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fphi_1231
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Fphi_1231
Enzymes [BR:fph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Fphi_1231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1339180..1340049
Genome map
AA seq 289 aa AA seqDB search
MKKVEAVGIAIGNAGREIGCGRAPYALLNELRDRRLDAQIINYIGGRAEVPTMGKYFTKV
AQTVSEILKEGKFPLALGGDHSCAIGTWSGVYDYLKSQKKELGLIWIDAHMDSHRPDTSE
TGNIHGMPVAHLLGYGHEELIKVLNDNPKLKPENIVFFGIRSYEKPEREFLEKLGVKVYY
QTDLTDRNFEELFLQEFERLEKVTEGNVGISFDLDGLDPTNLDAVGTPVENGIDPQVFYK
TIEKINFNSLVCFEVAEYNPLIDKTEISLKYMSKLIRLVEGNIKNLTQK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagaagcagtaggaatagctattggtaatgctggcagagaaattggttgc
ggaagagcaccatacgctttgttgaatgagttaagagatagacgtttagatgctcaaata
atcaattacattggcggaagagctgaagtacctactatgggtaaatattttactaaggtg
gctcagacggtatctgagattcttaaagaaggtaagtttcctttagctcttggaggagat
cactcatgtgcaataggtacatggagtggagtttatgattatcttaaaagtcagaaaaaa
gagcttggtttgatttggattgatgcgcatatggatagtcatagaccagacacttctgag
actggtaatatacatggtatgcctgtagcacatcttttaggatatggccatgaggaatta
ataaaggtactaaatgataatcctaagttaaagcctgaaaatattgtcttttttgggatt
cgctcttatgaaaagccagaaagagagtttttggaaaaattgggtgttaaagtttattat
caaactgatttaactgataggaactttgaagagttatttttacaagagtttgaacgtctt
gagaaggttacagagggtaatgtggggattagttttgacttagatggtttagatcctact
aaccttgatgctgtaggaactcctgttgaaaatggtattgacccacaagttttttacaaa
actattgagaaaattaattttaatagtttggtatgttttgaagtggcagaatacaatcct
ctgattgataaaacagaaatctcgcttaaatatatgtcaaaactaataagattagttgaa
ggtaatataaaaaatctaactcaaaaatag

DBGET integrated database retrieval system