KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_1251Help
Entry
Fphi_1251         CDS       T00652                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
fph00521  Streptomycin biosynthesis
fph00523  Polyketide sugar unit biosynthesis
fph01130  Biosynthesis of antibiotics
Module
fph_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Fphi_1251
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Fphi_1251
Enzymes [BR:fph01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Fphi_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABZ87476
JGI: Fphi_1251
UniProt: B0TXL8
Position
1367060..1367632
Genome map
AA seq 190 aa AA seqDB search
MKFMRTHINDIIICEPTVHSDDRGYFVETFRQDKLFDFLGYKINFCQDNESKSSYGVLRG
LHYQLAPHAQTKLVRVIQGRVLDVAVDIRKGSPTFGQYVAVELSAENKKQILIPRGFAHG
FVVLEDDTVFAYKVDSYYSPECDRGIAFDDKSIAIDWQVPVDMLKLSAKDRGQPKLDDTV
DLFEYGKSYY
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatgcgtacacatatcaacgatattattatttgtgagccaactgttcacagt
gatgatagaggttattttgtagagacttttcgtcaagataaactctttgatttcttaggt
tataagattaacttttgccaagataatgagtctaagagttcttatggtgtgctcagagga
ttacattatcagctagctccacatgcacagaccaagctagttagagtgatccaaggtaga
gtgttagatgttgctgtagatattcgtaagggtagtcctacttttggtcaatatgtcgcg
gttgaattaagtgctgagaataaaaaacaaatacttataccaagaggttttgctcatggt
tttgtagttttagaggatgatactgtatttgcatataaggtcgatagttattactctcct
gagtgtgatagaggcatcgcttttgatgataagagtatcgctatagattggcaagtacct
gttgatatgctaaagttgtcagcaaaagataggggtcaaccgaaattggatgatacagtt
gatttatttgagtatggtaaaagttattactaa

DBGET integrated database retrieval system