KEGG   Francisella philomiragia: Fphi_1313Help
Entry
Fphi_1313         CDS       T00652                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fph  Francisella philomiragia
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Fphi_1313
Enzymes [BR:fph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Fphi_1313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1429864..1430622
Genome map
AA seq 252 aa AA seqDB search
MKILVCRPKDDADKLSQLLRSKGYTATSLPCINIDYIRIASSVLGYTSYIFTSKYAVESL
FAQYNPELFHDKKLYSVGQSTAKTLKKYGLDAIYPHDHGSQELLKLILEEDVSDDSFAVI
SGVSGNELLVKEISQLTKCDKFETYQRVFESVAALSQAYLKFIDDGINPDVIVTTSIDIF
KSLNRIFGEIVAPRAAIVTITSPKMLKFVNEQGFENTLKLEKLDNNCIYQKIREHIEAKN
VTGKKYSARANQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattagtttgtcgccctaaggatgatgctgataagctttcacaattactaaga
tctaaagggtatacagctacgagtctaccatgtattaatatagattacattagaatagca
agttcagtactgggttatacaagttatatatttactagtaaatatgctgttgaaagttta
tttgctcaatataatcctgaattatttcatgataaaaaactctacagtgtaggtcaaagc
accgcaaaaactctaaaaaaatatggtttagatgctatatatccacacgatcatggttca
caagagcttttgaagctaatcttggaagaagatgtttctgatgatagttttgcggttatc
tctggggtttctggaaatgaattgcttgtcaaagaaatatcgcaactaacaaagtgcgat
aaatttgaaacttatcagagagtttttgagagtgttgctgcgcttagccaagcgtattta
aaatttattgatgatggtataaatcctgatgttattgttaccacaagtatcgatattttt
aagtctctgaataggatttttggcgaaatagtagctccaagagctgcaattgttaccata
acaagcccaaaaatgctaaaatttgttaatgaacaaggctttgaaaatactttgaagctt
gagaaattagataataactgtatctatcaaaaaatacgagaacatattgaggctaagaat
gtcacaggaaaaaaatattcagcaagagcaaaccaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system