KEGG   Francisella philomiragia: Fphi_1332Help
Entry
Fphi_1332         CDS       T00652                                 

Definition
exodeoxyribonuclease V (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fph  Francisella philomiragia
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fph00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Fphi_1332
Enzymes [BR:fph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Fphi_1332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1454723..1456495
Genome map
AA seq 590 aa AA seqDB search
MYKTFHQACEQLADIRAIDFFFAKEVFDLVKKTTPSIITLSSELYPPLHGAKGNDLEQKS
NEVLFHILIKLMHVYSHGHSCLKIADISNKTIFASEQSTQSDAKVGFKMPSFDEIVSILE
SLDYDKLPIYFAKEYDSLYIKRLWNYEVEIANFIKSRTIQNIQQANNIEEVVDKLFEPAD
EIDWQKQAVIKSLNYNFSIISGGPGTGKTTTVAKLLLAIQMSNQNQQRIALLAPTGKAAQ
RMRESLNSVLSKRVDNDSYLGLSNLEAQTIHRFLGLRPNSTHVKYNEQSKAPYDVIIVDE
ASMLDMNIFIKLIRAVADNTKLILIGDTNQLPSVEAGSLLANFTHHRDGDITPYTTLLIK
NYRSQQYINNLAASVLKGDINTDNHQNENINFHSIRNLDTYLREYAKRYSQLEKCRDYKE
ALTELNKFRILVANKNLEIGTDKLNQKIEKFMSKPIDSNYKGKPIMITQNSYSLGLFNGD
VGIIWPDDTGKLRAYFDGKDAKAFSLNMLPKYESVYAMTIHKTQGSEFDEIVIILPAEDN
EALCKQLLYTAITRAKHKLTIISEQSSLRDIAQKDIKRNSNISELVSLNN
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaactttccatcaagcttgtgagcaattagcagatattagagctatagatttt
ttctttgctaaagaagtgtttgatttagtcaaaaagactaccccgtctataatcactttg
tcaagtgagttatatccaccccttcacggagcgaaggggaacgatttggaacaaaaaagt
aatgaagttttatttcatattttgataaagcttatgcatgtatatagccatggtcatagc
tgtttgaagatagcagatatatcaaataaaactatttttgcttcagagcaaagcactcag
agcgatgctaaagtaggctttaaaatgccaagttttgatgaaattgtaagtattttagag
tccttagattatgataaattacctatatatttcgctaaagagtatgattccttatatatc
aaaagattgtggaattatgaggttgaaatagctaactttataaaatcaagaactatccaa
aatattcaacaagccaacaacattgaagaagttgtagataagctatttgaacctgctgat
gagatagattggcaaaaacaggcagttatcaaaagtctaaattataattttagtattatc
tcaggtggacctggcacaggtaagacaactacagtcgcaaaacttttgcttgctatacaa
atgagtaatcaaaatcagcaaagaatagctcttttagcaccaacaggtaaggctgctcag
agaatgagggaatccttaaatagtgtgttaagtaaaagggtagacaatgatagttattta
ggattatctaatctagaagctcaaactatacatagatttttaggcttaagaccaaactct
actcatgtgaaatataacgagcagtcaaaagcaccatacgatgtgattattgttgatgaa
gcttcgatgcttgatatgaatatttttattaagttgattagagcagtagccgataatacc
aagctaattttgataggtgatactaatcagttaccatcagttgaggctggtagtcttttg
gcaaactttacacaccacagagatggcgatattacgccatatacaacattacttatcaaa
aactatcgttcacaacaatatataaataatcttgcagcctcagttctaaaaggcgatatt
aatactgataatcatcaaaatgagaatattaattttcatagcataaggaatttagatact
tatttaagagagtatgcaaagagatattcacagcttgaaaagtgccgtgactacaaagag
gctcttaccgagctaaataaatttagaatacttgtagctaataaaaatttagaaattggt
acagataagttaaatcagaaaattgagaaatttatgtctaagcctatagattctaactat
aagggtaaaccaattatgataactcaaaatagttattcattgggattattcaatggagat
gtagggattatctggccagatgatactggtaagcttcgagcatattttgatggtaaagat
gctaaggcttttagtctaaatatgctaccaaaatatgaaagtgtttatgccatgacaatt
cataaaactcaaggttcagagtttgatgaaatcgtgattattcttccagcagaagataat
gaagcgctatgtaaacagcttctgtatacagctattaccagagcgaaacataaattaacg
attatttctgaacaaagtagtttaagagatattgctcagaaagatattaagagaaattca
aatattagtgaattagttagcttgaacaattaa

DBGET integrated database retrieval system