KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_1568Help
Entry
Fphi_1568         CDS       T00652                                 

Definition
(GenBank) Holliday junction DNA helicase, subunit A
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
fph03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:fph00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Fphi_1568
Enzymes [BR:fph01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Fphi_1568
DNA repair and recombination proteins [BR:fph03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Fphi_1568
    RecFOR pathway proteins
     Fphi_1568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH 5_3_exonuc Transposase_20 HHH_3 IMS_HHH Herpes_glycop_H
Motif
Other DBs
NCBI-ProteinID: ABZ87794
JGI: Fphi_1568
UniProt: B0TZE1
Position
1700737..1701393
Genome map
AA seq 218 aa AA seqDB search
MMISFIKGTLIEKDPTALLIDVNGLGYEVFVPMTTFYSLGEINSQVSLYTHFVVREDAQQ
LYGFKTKVDKKVFQELIKVSGIGARTAIAILSGMDSTTLLHCIENKDYGLLATVPGIGKK
TAERLVVEIYDKLLKMANEIYSQSSNTSASINANSVQHAQTPAAISNSIFSESVDALLAL
GYKQKDAEKMIRGTIGESTTAAEAIRKALQGSIRSKNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgatgattagttttattaaaggtactttgattgaaaaagatcctacagctttgcttata
gatgtaaatggcttaggatatgaagtttttgttccaatgactacgttttactcattgggt
gaaattaatagtcaagttagtctttatacgcattttgtagttcgtgaagatgctcaacag
ttatatggttttaaaacaaaggttgataaaaaagtctttcaagaattaatcaaagtaagt
ggaataggtgctaggacagctattgcaatattatcaggtatggattctacaacacttttg
cattgtatcgagaataaagattatgggttattagctactgtaccaggtattgggaaaaaa
acagctgagcgtttggttgttgagatctatgataaattattaaaaatggcaaatgagatt
tatagccaatcatctaatacttcagcatctataaatgctaatagtgttcagcacgctcaa
actccggcagctatttcaaactcaatttttagtgagtcagtagatgcacttttagctctt
ggctataaacaaaaagatgcagagaaaatgattcgtggtactattggagaatcaacaaca
gctgctgaagcaattcgcaaggctctacaagggtctataagatcaaaaaataaataa

DBGET integrated database retrieval system