KEGG   Francisella philomiragia: Fphi_1645Help
Entry
Fphi_1645         CDS       T00652                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fph  Francisella philomiragia
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Fphi_1645
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Fphi_1645
Enzymes [BR:fph01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Fphi_1645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1776605..1777075
Genome map
AA seq 156 aa AA seqDB search
MSIYDFKLTKNDGSEYSLPNNKVLLIVNVASKCGFTKQYKGLQHLHKLYPDLEIVAFPCN
SFGGQEPGSDEEIKSFCETNYDVTFPIMKKTKVNGKDAEPLFEYLKERAKGVLGTEAIKW
NFTKFLVSKDGETVIRYAPKTIPEDLISDIENFLKD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttatgattttaaattaactaagaatgatggctcagaatattctttacctaat
aataaggttcttttgatagttaatgttgcaagtaagtgcggatttactaagcaatataaa
ggacttcagcatttacataaattatatcctgatctagagatagtggcttttccatgtaac
tcatttggtggacaagaacctggtagtgatgaagaaatcaaaagtttttgtgaaactaac
tatgatgttacatttccaataatgaaaaagacaaaagtaaatggtaaagatgcagaacca
ttatttgaatatcttaaagaaagagcaaaaggtgtacttggtaccgaagctataaaatgg
aattttacaaaatttttagtatcaaaagatggtgagactgtcattaggtatgcacctaaa
acaattcctgaagatctaatatctgatatcgagaattttcttaaagattaa

DBGET integrated database retrieval system