KEGG   Francisella philomiragia: Fphi_1784Help
Entry
Fphi_1784         CDS       T00652                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fph  Francisella philomiragia
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fph00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1910109..1910729
Genome map
AA seq 206 aa AA seqDB search
MNDKYCSKLGRDVQQHLIKLGLEQARNFELDNNAKIAKISKAYREILDALGLQTHEFEKT
PFRVARMFTQEIFNGLEYANFPACALYENEFKYEGILTQKNITIMSFCEHHFVPFEGIAE
VSFIPKNNNIIGLCRINSICNFFSRRPQIQERMTAQIFETLKFILSTDDVSVKIKAKHTC
VSFRGTNNQNSETYTEMLGGVFAKKE
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaatgataaatactgttctaagctaggtagagatgtacaacaacatctcataaaatta
ggtctagaacaagctagaaattttgaacttgataacaatgctaaaattgctaagatctca
aaagcatatcgtgaaatattagatgctctaggcttacagacacatgaatttgaaaaaaca
ccttttagagtagctaggatgtttactcaagaaatattcaatggcttagaatatgctaat
tttccagcttgtgcattatatgagaatgaatttaagtatgaaggaatacttacacaaaaa
aatataactataatgtcattttgtgagcatcattttgtaccatttgaaggtattgctgaa
gtttcatttattcctaaaaataataatattataggcttatgtcgtatcaatagtatttgc
aactttttttcaagacgtccacaaatacaagaaagaatgactgctcaaatatttgaaact
ctaaaattcatcctctcaacagatgatgtaagtgtaaagataaaagcaaaacacacttgt
gtatcatttagaggtacaaataatcaaaactctgaaacatacaccgaaatgcttggtggt
gtctttgctaaaaaagaatga

DBGET integrated database retrieval system