KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_1784Help
Entry
Fphi_1784         CDS       T00652                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
fph00790  Folate biosynthesis
fph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fphi_1784
Enzymes [BR:fph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Fphi_1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ABZ88011
JGI: Fphi_1784
UniProt: B0U0Q8
Position
1910109..1910729
Genome map
AA seq 206 aa AA seqDB search
MNDKYCSKLGRDVQQHLIKLGLEQARNFELDNNAKIAKISKAYREILDALGLQTHEFEKT
PFRVARMFTQEIFNGLEYANFPACALYENEFKYEGILTQKNITIMSFCEHHFVPFEGIAE
VSFIPKNNNIIGLCRINSICNFFSRRPQIQERMTAQIFETLKFILSTDDVSVKIKAKHTC
VSFRGTNNQNSETYTEMLGGVFAKKE
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaatgataaatactgttctaagctaggtagagatgtacaacaacatctcataaaatta
ggtctagaacaagctagaaattttgaacttgataacaatgctaaaattgctaagatctca
aaagcatatcgtgaaatattagatgctctaggcttacagacacatgaatttgaaaaaaca
ccttttagagtagctaggatgtttactcaagaaatattcaatggcttagaatatgctaat
tttccagcttgtgcattatatgagaatgaatttaagtatgaaggaatacttacacaaaaa
aatataactataatgtcattttgtgagcatcattttgtaccatttgaaggtattgctgaa
gtttcatttattcctaaaaataataatattataggcttatgtcgtatcaatagtatttgc
aactttttttcaagacgtccacaaatacaagaaagaatgactgctcaaatatttgaaact
ctaaaattcatcctctcaacagatgatgtaagtgtaaagataaaagcaaaacacacttgt
gtatcatttagaggtacaaataatcaaaactctgaaacatacaccgaaatgcttggtggt
gtctttgctaaaaaagaatga

DBGET integrated database retrieval system