KEGG   Francisella philomiragia: Fphi_1807Help
Entry
Fphi_1807         CDS       T00652                                 

Definition
short chain dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
fph  Francisella philomiragia
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Fphi_1807
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Fphi_1807
Enzymes [BR:fph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Fphi_1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1932208..1932990
Genome map
AA seq 260 aa AA seqDB search
MSVKNKVTLITGAASGLGLGMATEFAKQGAKVVIADLDLEKSQAVAKDLADKYTVETLAV
QMDVTNEDQVKSGVDQTVKKFGRIDTVINNAGIQIISPIVDFSVSAWKKLFDIHMTGTLL
VTQAAMRHIIELKTGGRIIVVGSVHSVLASKNKAAYVAAKHAQVGFVRALAKEGAEHNIS
SNLIGPGFVMTPLVEKQIPEQAKELNISEEEVVKNIMLGGTVDGEFTTVQDIADTAIFLA
GFKTNALTGQKILVSHGWGM
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaaaataaagtgactttaattactggagctgcatcaggtcttggactaggt
atggcaacagaatttgcaaaacaaggcgctaaagtagtaatcgcagatttagatctagaa
aaatcacaagctgtagcaaaagatttagcagataaatatactgtagaaactttagctgta
caaatggatgttacaaatgaagaccaagtaaagtcaggtgtagatcaaactgtcaaaaaa
tttggtcgtatcgatactgtgattaataacgcaggtattcagataatatcacctatagta
gattttagtgtatcagcttggaaaaaattatttgatatccatatgactggtacattactt
gtaactcaagcagctatgagacatattattgaactaaaaactggtggtagaattatagtt
gtaggttctgttcactcagttcttgcatcaaaaaataaagcagcttatgtagcagctaaa
cacgcacaagttggttttgtaagagctttagcaaaagaaggtgctgagcacaatatctca
tctaacctaattggtccaggttttgtgatgactccattagtagaaaaacaaattccagaa
caggcaaaagagctaaatatcagtgaagaagaagttgtaaaaaacattatgcttggtggc
actgttgatggtgaatttacaactgttcaagatattgctgatactgcaatatttttagca
ggatttaaaacaaatgcattaactggtcagaaaattttggtaagtcatggttggggaatg
taa

DBGET integrated database retrieval system