KEGG   Francisella philomiragia: Fphi_1807Help
Entry
Fphi_1807         CDS       T00652                                 

Definition
short chain dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
fph  Francisella philomiragia
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:fph00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:fph00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1932208..1932990
Genome map
AA seq 260 aa AA seqDB search
MSVKNKVTLITGAASGLGLGMATEFAKQGAKVVIADLDLEKSQAVAKDLADKYTVETLAV
QMDVTNEDQVKSGVDQTVKKFGRIDTVINNAGIQIISPIVDFSVSAWKKLFDIHMTGTLL
VTQAAMRHIIELKTGGRIIVVGSVHSVLASKNKAAYVAAKHAQVGFVRALAKEGAEHNIS
SNLIGPGFVMTPLVEKQIPEQAKELNISEEEVVKNIMLGGTVDGEFTTVQDIADTAIFLA
GFKTNALTGQKILVSHGWGM
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaaaataaagtgactttaattactggagctgcatcaggtcttggactaggt
atggcaacagaatttgcaaaacaaggcgctaaagtagtaatcgcagatttagatctagaa
aaatcacaagctgtagcaaaagatttagcagataaatatactgtagaaactttagctgta
caaatggatgttacaaatgaagaccaagtaaagtcaggtgtagatcaaactgtcaaaaaa
tttggtcgtatcgatactgtgattaataacgcaggtattcagataatatcacctatagta
gattttagtgtatcagcttggaaaaaattatttgatatccatatgactggtacattactt
gtaactcaagcagctatgagacatattattgaactaaaaactggtggtagaattatagtt
gtaggttctgttcactcagttcttgcatcaaaaaataaagcagcttatgtagcagctaaa
cacgcacaagttggttttgtaagagctttagcaaaagaaggtgctgagcacaatatctca
tctaacctaattggtccaggttttgtgatgactccattagtagaaaaacaaattccagaa
caggcaaaagagctaaatatcagtgaagaagaagttgtaaaaaacattatgcttggtggc
actgttgatggtgaatttacaactgttcaagatattgctgatactgcaatatttttagca
ggatttaaaacaaatgcattaactggtcagaaaattttggtaagtcatggttggggaatg
taa

DBGET integrated database retrieval system