KEGG   Francisella philomiragia: Fphi_1808Help
Entry
Fphi_1808         CDS       T00652                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
fph  Francisella philomiragia
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Fphi_1808
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Fphi_1808
Enzymes [BR:fph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Fphi_1808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1933050..1934717
Genome map
AA seq 555 aa AA seqDB search
MPTNSNIRQKLGQLIMLDFRYWGEDSNNQRIPFTKTNDIVNKIFKNYNLGGFILFRENIQ
NNEQVISLLRDLQANTNTPIFFATDQEGGRVNRLQQGTSGCGNMALAATDNPSNAYTMAK
IIGDELYSLGININFAPAVDVNSNKNNPIIGVRSYSDNPNVVTDYAKNAINGYHDAKIID
CIKHFPGHGDTATDSHLGNVILDKTLKELQTTELLPFSKLARDCSMIMTAHISVPALDDT
QYQSVSTSENIYVPTTLSYKIITKLLKQQMKFDGLVVSDAMDMHAIAKHFGTIEASKLAI
LAGIDILLMPIRVWSENDLYKLEELFCELENEYNQNPNFANAVDSAYTNITDFKAKHKLD
KSLIFKLSYDEQLKYANQIVNCSKHQQISLDIAKQSTTVVKNLGIIPCNLNMLKNILIVD
SDRQRMADFHNELQKIVSKNNSAIIINSENIDNQDIKNSIENADLILLISANLREYNKAY
SYVTSIKPKQTINIAALAPYDINYIDNIINYVCIYGATSMDQTNYTKTSLKINIQAALEN
IFSDNILTGKLPVQI
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcctacaaactcaaatataagacaaaagctaggtcaactaattatgttggattttcgc
tattggggtgaagattcaaataatcaacgtataccttttacaaaaaccaatgatatcgtc
aataagatctttaaaaattataatctaggtggttttatcctttttagagagaatattcaa
aataatgagcaagttatctctctattaagagatcttcaagctaacaccaatacaccaata
tttttcgctacagatcaagaaggtggtagagttaatcgcttacaacaaggtactagtggc
tgcggtaatatggcactagctgcgacagataatcctagtaatgcttatactatggctaaa
ataattggtgatgaattatattctttaggtatcaatattaattttgctccagctgtagat
gtcaactctaacaaaaataatcctattattggtgtaagatcttactcagataatcccaat
gtagttactgactatgccaaaaatgctataaatggttatcatgatgctaaaatcatagac
tgcattaagcacttccctggtcatggtgatactgcaacagatagtcatttaggtaatgta
atcttagataaaactttgaaagaattacagacaacagaactactaccttttagtaaactt
gctagagattgtagtatgataatgacagctcatattagtgtaccagccctagatgatacc
cagtaccaatcagtttcaacaagtgaaaatatttatgtgccaactactctttcttataag
ataataactaaattactaaaacaacaaatgaaatttgacggtctagtagtatctgatgct
atggatatgcacgctattgctaaacactttggaactattgaagcttctaaattagctatc
ttagctggtatagatattttattaatgcctattcgagtatggtcagaaaatgatctttat
aagttagaagagcttttttgtgaactagaaaatgaatataatcaaaatcctaattttgct
aatgcagttgatagtgcctacacaaatattactgatttcaaagcaaaacataaactcgat
aaaagtttaatattcaaactctcatacgatgagcaattaaaatatgctaatcaaatagtt
aattgtagtaaacatcaacaaatatctctagatatagccaagcaaagtacaacagtagtt
aaaaatttaggtattattccatgcaatctcaatatgctaaaaaatattttgattgtagat
agtgatagacaacgtatggcagattttcataatgagttacaaaaaatagtatcaaaaaat
aactctgctattatcataaactctgaaaatattgataatcaagatataaaaaatagtatc
gagaatgctgatttaattttgctaatctcagcaaacctgcgtgaatacaataaggcttat
agttatgtaacttctataaagccaaagcaaactataaatatcgcagcacttgctccttat
gatattaactatatcgataatattattaattatgtttgtatttatggtgcgacgtctatg
gatcagacaaattatacaaagacttcactaaagattaatattcaagcagcattagaaaat
atttttagtgataatatcctaacaggaaaattgcctgttcaaatttaa

DBGET integrated database retrieval system