KEGG   Francisella philomiragia: Fphi_1878Help
Entry
Fphi_1878         CDS       T00652                                 

Definition
acyl-coenzyme A synthetase/AMP-(fatty) acid ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fph  Francisella philomiragia
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fphi_1878
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fphi_1878
   00620 Pyruvate metabolism
    Fphi_1878
   00640 Propanoate metabolism
    Fphi_1878
  Energy metabolism
   00680 Methane metabolism
    Fphi_1878
Enzymes [BR:fph01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Fphi_1878
Lipid biosynthesis proteins [BR:fph01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Fphi_1878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2007200..2009143)
Genome map
AA seq 647 aa AA seqDB search
MSYSNFQVSEEFIAQANVNAEQYEAMYQESIENPEAFWSKQANYISWHKPFDKAFASSFD
PVDIQWFKGGELNVCYNCVDRHLVDKANKVAFVWQADDPYHTKNITYRDLYHRVCEMANI
LEANGVKKGDVVTIYMPMIPEAIYAMLACARIGAMHSVVFGGFSAEALKQRIINANSKFV
ITADESIRSGKRIPLKKSVDRAISGLDFVRNVLVVSRTKTKDMVWNDIDLCYEKECAKVS
DEHKIEFFDAETPLFMLYTSGSTGTPKGLVHTSGGYLVYASMTHKLAFDLKDDDVYWCTA
DIGWITGHSYAVYGPLANGCTSLIFEGVPTYPDASRMWKEVDRHNVKSLYTAPTLIRLLI
KAGDQYLKDSDRTSLRVLGSVGEPINPEAWNWFVEKGANNQAPLVDTWWQTETGGHMILP
LPGAHKLKPGSASKPFFGVDVALLDTDGKEIEGVGKGALCIRTATPGMARTIYGDHDRYI
QTYFSSFKGFYFSGDAARRDEDGYIWIEGRMDDVINVSGHRMATAEIEAVLNTHSSVAES
AVVGMPHDIKGEAIYVYCILKDGHDGKGAGDEYLDSIRKTLVSYIRQEIGPVASPDVIQF
TPDLPKTRSGKIMRRILRKIAANDFDNLGDTSTLLDPSIVEYLIKNR
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtcatattcaaattttcaagtttcagaagagtttatagctcaagctaatgttaatgcc
gagcaatatgaagctatgtatcaagaatcaatagaaaatccagaagcattttggtcgaag
caggctaattatattagctggcataaaccttttgataaggcttttgcaagtagctttgat
cctgtagatattcaatggttcaaaggtggtgagctaaatgtttgttataactgtgttgac
aggcatttagtagacaaggcgaacaaggttgcttttgtatggcaagctgatgacccgtat
cacactaagaatattacgtacagagatctctatcatagagtatgtgagatggctaatata
cttgaggcaaatggtgtcaaaaaaggagatgtcgtaactatatatatgccaatgatacca
gaggcaatatatgcgatgcttgcttgtgcgcgtataggagctatgcactcagttgtattt
ggaggtttctcagcagaagcacttaagcagagaattataaatgcaaatagtaaatttgta
attacggcagatgaaagtattagatcaggaaagagaatacctcttaaaaaaagtgtagat
agagcaatctctggtttagacttcgttagaaatgtcctagttgtgagtagaactaagaca
aaagatatggtttggaacgacatagatctttgttatgaaaaagagtgtgctaaggtctcc
gatgagcataagatagaattctttgatgcagaaactccattgtttatgctatatacttca
ggctcaactggtactccaaaaggtcttgttcatacctcaggaggctatcttgtttacgca
agtatgactcataaattagcttttgatctaaaagatgatgatgtatattggtgtaccgct
gatattggttggattactgggcatagttatgctgtttatggtccgcttgctaatggttgt
acctctctaatctttgaaggtgttccaacatacccagatgcttctagaatgtggaaagaa
gttgatagacataatgtgaaatccctatatacagccccaactttgatcagattattaatc
aaagctggagatcagtaccttaaagattcagatagaacttcattaagagtattaggatct
gttggagaacctattaatccagaagcatggaactggtttgtagagaagggcgcaaataat
caagcacctcttgttgatacttggtggcaaactgaaactggtggacatatgattctgcca
ttaccaggtgctcataaactaaaaccaggatcggcatctaaacctttctttggtgttgac
gtggctttattagatactgatggtaaagagattgaaggggttggcaaaggagctctatgt
attagaactgcgactcctggtatggctagaactatttatggtgaccatgatagatatatt
caaacatactttagcagtttcaaaggtttctatttctcaggtgatgcagccagaagagat
gaagatggttatatatggatagaaggtcgtatggatgatgttattaacgtatcaggccat
agaatggcaactgctgaaatagaagctgtattgaatactcattctagcgttgcagaatca
gctgtagttggtatgcctcatgatatcaaaggtgaagcaatttatgtctattgcatacta
aaagatggtcatgatggcaaaggtgctggagatgagtatcttgatagtatcagaaaaaca
ttagtatcttatattagacaagagattggtccagtagcaagtccagatgtgattcagttt
actccagatttaccaaaaactcgttctggtaaaattatgagaagaattttgagaaaaata
gctgcaaatgattttgataatttaggtgacacatctacacttttagatccgagtatagta
gagtatctgataaaaaacaggtag

DBGET integrated database retrieval system