KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_1878Help
Entry
Fphi_1878         CDS       T00652                                 

Definition
(GenBank) acyl-coenzyme A synthetase/AMP-(fatty) acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
fph00010  Glycolysis / Gluconeogenesis
fph00620  Pyruvate metabolism
fph00640  Propanoate metabolism
fph00680  Methane metabolism
fph01100  Metabolic pathways
fph01110  Biosynthesis of secondary metabolites
fph01120  Microbial metabolism in diverse environments
fph01130  Biosynthesis of antibiotics
fph01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fphi_1878
   00620 Pyruvate metabolism
    Fphi_1878
   00640 Propanoate metabolism
    Fphi_1878
  Energy metabolism
   00680 Methane metabolism
    Fphi_1878
Enzymes [BR:fph01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Fphi_1878
Lipid biosynthesis proteins [BR:fph01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Fphi_1878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABZ88104
JGI: Fphi_1878
UniProt: B0U185
Position
complement(2007200..2009143)
Genome map
AA seq 647 aa AA seqDB search
MSYSNFQVSEEFIAQANVNAEQYEAMYQESIENPEAFWSKQANYISWHKPFDKAFASSFD
PVDIQWFKGGELNVCYNCVDRHLVDKANKVAFVWQADDPYHTKNITYRDLYHRVCEMANI
LEANGVKKGDVVTIYMPMIPEAIYAMLACARIGAMHSVVFGGFSAEALKQRIINANSKFV
ITADESIRSGKRIPLKKSVDRAISGLDFVRNVLVVSRTKTKDMVWNDIDLCYEKECAKVS
DEHKIEFFDAETPLFMLYTSGSTGTPKGLVHTSGGYLVYASMTHKLAFDLKDDDVYWCTA
DIGWITGHSYAVYGPLANGCTSLIFEGVPTYPDASRMWKEVDRHNVKSLYTAPTLIRLLI
KAGDQYLKDSDRTSLRVLGSVGEPINPEAWNWFVEKGANNQAPLVDTWWQTETGGHMILP
LPGAHKLKPGSASKPFFGVDVALLDTDGKEIEGVGKGALCIRTATPGMARTIYGDHDRYI
QTYFSSFKGFYFSGDAARRDEDGYIWIEGRMDDVINVSGHRMATAEIEAVLNTHSSVAES
AVVGMPHDIKGEAIYVYCILKDGHDGKGAGDEYLDSIRKTLVSYIRQEIGPVASPDVIQF
TPDLPKTRSGKIMRRILRKIAANDFDNLGDTSTLLDPSIVEYLIKNR
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtcatattcaaattttcaagtttcagaagagtttatagctcaagctaatgttaatgcc
gagcaatatgaagctatgtatcaagaatcaatagaaaatccagaagcattttggtcgaag
caggctaattatattagctggcataaaccttttgataaggcttttgcaagtagctttgat
cctgtagatattcaatggttcaaaggtggtgagctaaatgtttgttataactgtgttgac
aggcatttagtagacaaggcgaacaaggttgcttttgtatggcaagctgatgacccgtat
cacactaagaatattacgtacagagatctctatcatagagtatgtgagatggctaatata
cttgaggcaaatggtgtcaaaaaaggagatgtcgtaactatatatatgccaatgatacca
gaggcaatatatgcgatgcttgcttgtgcgcgtataggagctatgcactcagttgtattt
ggaggtttctcagcagaagcacttaagcagagaattataaatgcaaatagtaaatttgta
attacggcagatgaaagtattagatcaggaaagagaatacctcttaaaaaaagtgtagat
agagcaatctctggtttagacttcgttagaaatgtcctagttgtgagtagaactaagaca
aaagatatggtttggaacgacatagatctttgttatgaaaaagagtgtgctaaggtctcc
gatgagcataagatagaattctttgatgcagaaactccattgtttatgctatatacttca
ggctcaactggtactccaaaaggtcttgttcatacctcaggaggctatcttgtttacgca
agtatgactcataaattagcttttgatctaaaagatgatgatgtatattggtgtaccgct
gatattggttggattactgggcatagttatgctgtttatggtccgcttgctaatggttgt
acctctctaatctttgaaggtgttccaacatacccagatgcttctagaatgtggaaagaa
gttgatagacataatgtgaaatccctatatacagccccaactttgatcagattattaatc
aaagctggagatcagtaccttaaagattcagatagaacttcattaagagtattaggatct
gttggagaacctattaatccagaagcatggaactggtttgtagagaagggcgcaaataat
caagcacctcttgttgatacttggtggcaaactgaaactggtggacatatgattctgcca
ttaccaggtgctcataaactaaaaccaggatcggcatctaaacctttctttggtgttgac
gtggctttattagatactgatggtaaagagattgaaggggttggcaaaggagctctatgt
attagaactgcgactcctggtatggctagaactatttatggtgaccatgatagatatatt
caaacatactttagcagtttcaaaggtttctatttctcaggtgatgcagccagaagagat
gaagatggttatatatggatagaaggtcgtatggatgatgttattaacgtatcaggccat
agaatggcaactgctgaaatagaagctgtattgaatactcattctagcgttgcagaatca
gctgtagttggtatgcctcatgatatcaaaggtgaagcaatttatgtctattgcatacta
aaagatggtcatgatggcaaaggtgctggagatgagtatcttgatagtatcagaaaaaca
ttagtatcttatattagacaagagattggtccagtagcaagtccagatgtgattcagttt
actccagatttaccaaaaactcgttctggtaaaattatgagaagaattttgagaaaaata
gctgcaaatgattttgataatttaggtgacacatctacacttttagatccgagtatagta
gagtatctgataaaaaacaggtag

DBGET integrated database retrieval system