KEGG   Francisella philomiragia: Fphi_1879Help
Entry
Fphi_1879         CDS       T00652                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fph  Francisella philomiragia
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Fphi_1879
   00052 Galactose metabolism
    Fphi_1879
   00500 Starch and sucrose metabolism
    Fphi_1879
   00520 Amino sugar and nucleotide sugar metabolism
    Fphi_1879
Enzymes [BR:fph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Fphi_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2009254..2010117)
Genome map
AA seq 287 aa AA seqDB search
MKIKKAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNK
KSLEDHFDRNFELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPL
VGIEDFAVILPDDLIYNHDCGTGTLKQMVKAVEGTDIRGCIATQQVKKEETSSYGIVAKD
SENLIKAIVEKPTPEKAPSTNAVVGRYLLPNKIFRCLESTSEGAGGEIQLTDAIAKLLDQ
EEKILSYEFKGTRYDCGSKLGFLIANYEIALQHKELGSKFKEYLQSR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaaaaagcagtctttccagttgctggttggggaactagatttttgccagca
actaaatcatgtcctaaagagatgttaactgttgtagacaaaccattgattcaatatgct
gttgaggaagctatcgaagcaggctgtaaggaaattatttttgttacaagttctaacaaa
aaatctcttgaagatcattttgatagaaattttgaattagagtattcgttagagaaaaag
caaaagtatgaactattagatttagtcaaaaacataattccgaaagatgtaagctttttc
ttcgttcgtcagccagaagctctaggcttaggtcatgctgtgctatgtgcaaaacctctt
gttggaatcgaagactttgcggtgatattgccggatgatttaatctataatcatgattgt
ggtactggtacccttaagcaaatggtaaaagctgtagaaggtactgatatcagaggatgt
atagctactcaacaagtcaaaaaggaagagactagctcttatggtatcgtagctaaagat
agtgagaatcttatcaaagcaatagttgagaaaccaactccagaaaaagcaccatcaact
aatgcggttgtgggaagatatctattgcctaacaaaattttcagatgtttagaatcaact
tcagaaggtgcaggcggagagattcaattaactgatgcaatcgctaaactactcgatcaa
gaagaaaaaattctatcttatgaatttaaaggcactcgttatgactgtggtagtaagctt
ggatttttaatcgctaactatgaaatagctctacagcacaaagagttaggtagtaaattc
aaagaatatcttcaaagtagataa

DBGET integrated database retrieval system