KEGG   Francisella philomiragia: Fphi_1885Help
Entry
Fphi_1885         CDS       T00652                                 

Definition
restriction endonuclease
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
fph  Francisella philomiragia
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2016541..2019396)
Genome map
AA seq 951 aa AA seqDB search
MLFEKQQYQEDCVNNIVSILDECDVFNNDYSNLKNIIKEHYKTQRYSQFETSNKKQIDVL
METGTGKTFTYIKTIFEINKQFGKTKFIIVLPRTAIKQGVIQNIKLTNEYFYNEYGKHLK
FIDYTGKDSLSAVQQSFIRNESDLTVLVSTNSAFNKDANTINQAKEDLIEHSSVWEAIAD
KKPIVFIDEPHLLKGGATVEALEKLDSLFIRFGATYPTEEQHKLVNVAYALDSINSFENY
LVKRIAVKNILTGAEESDIKITKIIAKGKQADKSVTFSYSKNQQIYSTTIKIGDDVGSKT
GLDIYHGVTLTKINAKEIFFSNGDTKKVSESYELNDDEIEKMLRVTISNHFEKEERLFKQ
GIKELSLFFIPSIADFRGDNPILRKSFEKIYREIRDECYQNTTNQEYKKYLDRDFKDGKL
QVLEGYFSGDKGTADDKIKSGVDKILNKKEQLLSLDEPLRFVFSVWALQEGWDNPNIFNI
CKLATTDKETSRRQQVGRGLRLAVNQFGKRQSFKTLAENENAFYDINTLDVVVSGYEKDF
IEGIQSEIQKASFGIVGDFLEIESLKDKGLNDVEVFSLIGVLSAEKVIEINDGKYKVIGS
IYDFIENNADKLSFLSNARLQEIKELFKSRKPLVEDRNKAREKLKIRQKQAKKFKELWET
INRKAEIVYKDINEQEIITKIVDAFDKESFSQIDTKVITKVYDPIKDKVVTKEEQSLGKI
DFFAKNKLSEFVFEFSKKEKLPLGFVTKLFSKLNLQKIKNNPSKAINFIKSHIKESIHTS
ILQCVDYDFSQTNIFSKNILQNDDGSFIKEIEYTKLGRNIGDEASDEFLFDRVVYDSDIE
KQAILNDPTSIDGQQITVFAKLPSISIPTPYKAYNPDFAYLVDRGENQKQLFLVVETKGY
KNNSDIPQAEKTKIDYAKKFFEGLQKQLPNVDVKFKTRINKDELSDIIRNS
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgctatttgaaaaacaacaatatcaagaagattgtgtaaataatatcgtaagtatttta
gatgaatgtgatgtctttaataatgactattcaaatctaaaaaatataattaaagagcat
tataaaactcaaagatatagccaatttgaaacatctaacaaaaaacaaatagatgttttg
atggagactggtacaggtaaaacatttacttatataaaaactatttttgagataaataag
cagtttggcaagactaaatttattatagtgctaccgcgtacagctattaaacaaggtgtt
attcaaaatatcaaacttactaatgaatatttctataatgagtatggaaagcatttaaaa
tttatagattatacaggtaaagatagtttatcagcagtacagcaaagttttattcgtaat
gaatcagatttaactgtgcttgtatctactaattcagcgtttaataaagatgctaataca
atcaatcaagctaaagaagatcttattgaacatagtagtgtttgggaagctatagcagat
aaaaagccaatcgtgtttatagatgaaccacatttattaaaaggtggtgctactgtagag
gctttggaaaagctagatagcttatttattcgttttggtgctacatatccgacagaagaa
cagcataagctagtcaatgtcgcttatgctttggatagtattaactcatttgaaaactat
ctagtaaaaagaattgcagttaaaaatattcttacaggtgcagaagaatcagatattaaa
atcacaaagataattgccaaaggcaaacaagctgataaatctgtaacatttagttactca
aaaaatcagcaaatatactcaaccactatcaaaataggtgatgatgtaggctctaaaaca
ggtttagatatttatcatggtgttactcttacaaagattaatgcaaaagaaatatttttc
tctaatggtgatactaaaaaagttagtgaaagttatgagttaaatgatgatgaaattgaa
aaaatgcttagagttacaatttctaatcattttgaaaaagaagaaagactttttaaacaa
ggtattaaagaactatcactattttttatcccaagtattgcagattttagaggcgataat
cctatacttagaaaatcttttgagaaaatatatcgagagatccgtgatgaatgttatcaa
aacacaactaatcaagagtataagaaatatctagatagagactttaaagatggcaaacta
caagttttagaagggtacttctcaggagataagggtacagcagatgataaaataaaatca
ggagttgataaaatcttaaataaaaaagaacaacttctatcacttgatgagcctttaagg
tttgttttctcagtatgggctttacaagagggttgggataacccaaatatattcaatatt
tgcaaacttgctactacagataaagaaacatctagaagacaacaagtagggcgtggactt
agattagctgttaatcaatttggtaagagacaatcatttaaaactttagcagaaaatgaa
aatgcattttatgatattaatactctagatgtagtagtctcaggctacgaaaaggacttt
atcgaaggtatccaatcagaaatacaaaaagcgagttttggtattgtaggagatttttta
gaaatagaatctttaaaagataaaggtctaaatgatgttgaagtatttagtctaattggc
gtactatctgccgaaaaagttatagaaataaatgatggtaaatataaagtaataggtagt
atttacgactttatagaaaataatgctgataaattatccttcttatctaatgctagattg
caagagatcaaagagctatttaagtctagaaaacctcttgttgaagatagaaataaagct
agagaaaaattaaaaatccgtcaaaaacaagccaaaaagtttaaagagctgtgggagact
attaatcgcaaagcagaaatagtttataaagatataaatgagcaggagattatcactaaa
atagtagatgcttttgataaagaaagtttttctcaaatagatacaaaggttataacaaag
gtttatgaccctataaaagataaggttgtcaccaaagaggaacaatctctaggtaaaata
gatttctttgctaaaaataaacttagtgaatttgtatttgagttctctaaaaaagaaaaa
cttcctctaggttttgttacaaaactattcagtaaacttaatttacaaaagataaaaaat
aatccaagcaaagctattaactttataaaatcacatataaaagagtctatccataccagt
attttgcaatgtgttgactatgattttagccaaacaaatatatttagcaaaaatattctg
caaaatgatgatggtagctttattaaagaaattgagtatacgaaattaggtagaaatatt
ggggatgaagcgtctgatgagtttttatttgatcgagttgtttatgattcagacatagaa
aaacaggcaatattgaatgatcctacttcaatagatggtcagcaaataacagtttttgca
aaactaccaagtatatctataccaacaccatacaaagcatataatccagattttgcttac
cttgttgatagaggcgaaaaccaaaagcaattatttttagtggttgaaactaaaggctat
aaaaataatagtgatatccctcaagctgaaaaaacaaaaatagattatgctaaaaagttc
tttgaaggtttgcagaagcaattaccgaatgtggatgtgaagtttaagactaggattaac
aaagatgagctttcagatattataagaaacagctaa

DBGET integrated database retrieval system