KEGG   Ferroglobus placidus: Ferp_0104Help
Entry
Ferp_0104         CDS       T01172                                 

Definition
phosphoglucosamine mutase (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
fpl  Ferroglobus placidus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ferp_0104
   00030 Pentose phosphate pathway
    Ferp_0104
   00051 Fructose and mannose metabolism
    Ferp_0104
   00052 Galactose metabolism
    Ferp_0104
   00500 Starch and sucrose metabolism
    Ferp_0104
   00520 Amino sugar and nucleotide sugar metabolism
    Ferp_0104
  Nucleotide metabolism
   00230 Purine metabolism
    Ferp_0104
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ferp_0104
Enzymes [BR:fpl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Ferp_0104
    5.4.2.8  phosphomannomutase
     Ferp_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
86804..88141
Genome map
AA seq 445 aa AA seqDB search
MARELFGTNGVRGIANEELTAEMALNLGRTIATMKPGRIAIACDTRISSEMLKSAVIAGI
LSAGSDAVDLGVAPTPALQYYVKENNVDAGVIVTASHNPREYNGIKYIQEDGTEFTWEMD
EEAEKIYKSKSFRKARWNEVGRILRDDCIDLYVSGILEKVDAEEIERRKFRVVLDCGNGA
ASFTSPEILKRLNCEVLTLNCNPDGRFTARNPEPVDEHLDMLKEAVKAFKADFGVAHDGD
ADRATFVDEKGNFVSEDVTLAIMAKYYVEQHGGGVVVTPVSSSRCVEDVVREAGGEVVYT
AVGSPVVAKVMKEKNAVFGGEGNGGLIFPEHLLARDGGMSLAKFMELMALTGKKLSELAE
EIPKYHMIKLKVECRDRKRLLEGLRREFPEANFTDGARIDYEDGWLLIRPSGTEPIARIF
AEAKTESKAKELAEFGVSVVKKILG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcgagagagcttttcggaactaacggcgtgagaggaattgcgaacgaagagcttact
gccgaaatggcgctcaaccttggaagaactatagccacgatgaaaccggggagaattgct
atcgcatgcgatacgagaatttcttctgaaatgctgaaatccgctgttattgctggaatt
ctttctgctggaagcgacgccgttgacctcggcgtagctcctactccagctctgcagtat
tacgtgaaggaaaacaacgttgatgccggagtaattgtgacagcttcccacaatccgagg
gagtacaacggaataaagtacattcaggaagacggaactgaattcacttgggagatggat
gaggaggcggagaaaatatacaagagcaagagctttagaaaagcgagatggaatgaggtt
ggaaggattctgagagatgattgcatagatctttacgtttccggaattttagagaaagtt
gacgctgaggagatcgagaggaggaagttcagagtcgttttagattgtggaaacggtgca
gcaagctttacgtctccagaaattcttaagagattaaactgtgaggtgctgactttaaat
tgcaatccggatgggagatttacggcaaggaatccggagccggttgacgagcacttggac
atgcttaaagaagcggtgaaagcgtttaaagctgattttggagttgctcatgatggggat
gcggatagagcaactttcgtcgatgaaaagggaaatttcgttagcgaggacgtcactctc
gctataatggctaagtactacgtggagcagcacgggggaggagttgttgttactcccgta
agcagttcgaggtgcgttgaggacgtcgtcagagaggctggaggagaggtcgtttacaca
gccgttggctcgccggtagtggctaaggtgatgaaggagaagaacgctgttttcggtgga
gagggcaatggagggttgatatttccggagcatttgcttgcgagagacgggggaatgagc
ttggctaaattcatggaactcatggctttaactggcaaaaagctttctgaacttgctgag
gagattccgaagtaccacatgataaagctgaaggttgagtgcagagatagaaaaaggttg
ctcgaagggctcagaagagaatttccggaggcgaactttaccgacggagcgagaatagac
tacgaagacggctggcttctgataagaccctccggaactgagccgatagcgaggatattt
gcagaagctaaaaccgagagtaaagcgaaggagctggctgaatttggcgttagtgttgtg
aagaagattcttggctga

DBGET integrated database retrieval system