KEGG   Ferroglobus placidus: Ferp_0128Help
Entry
Ferp_0128         CDS       T01172                                 

Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
fpl  Ferroglobus placidus
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:fpl00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
111958..114039
Genome map
AA seq 693 aa AA seqDB search
MAEEKNAKKNNKRNNKNGETKLTRREFLSFGGGFIAGFAVGAGISRLGGGGAPAAPASFA
EIMEQRGLTQQDAIAALKTYTPGGKYDEFIMFASGGHSGQVLVIGVPSMRLYKVIAVFTP
EPWQGYGYGLKETHEVLKGGYNGIRPLSWGDTHHPEISRTNAEFDGEWLFINDKANGRAA
VISLKDFETKQIVKVPNTQTVHGGCFATPNTEYVAIVSQYATPWDPEKGGYIPGETYVEL
TEENYKKYFRGTYTFLAFDRKRGRFDLSKSFQIELPPYTQDLVAVGWGPSDGLAFCNSFN
TELAVGGVLKGKPPLEIGMSQNDFDYLHVILWKKAEQYVKEGGGEVINGIRVIRLKEAVK
EGLIYFVPEPKSPHGCDITPNGDYVCVSGKLDPVVTVYSVEKIKRAIEEKKFEKKDPYGV
PVLKFDEVVEAQIEVGLGPLHTEFDDKGYAYTSLFIDNAVARWKLGPPYNEDGWKVVERI
PINYNVGHLATPESNSPTPKGKYLVSLNKWSIERFPLVGPLHPQNFQLIDISGERMQLLY
DMPIGLGEPHYAKIISIEKLKPLDVYPAGTDPLTFQPHPKAIQQGQERIERKQENGKWVT
EIYATLIRSTITPDIMKAKVGDIVRIYLTNVEYTRDATHGFCIAEYNINASLEPGETGTI
EFVADKPGVYAIYCTEFCSPLHLEMAGWLVIEP
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggagaagaatgcgaaaaagaacaacaagagaaacaataaaaacggggagact
aaattaacaagaagagaatttcttagcttcggaggaggttttatcgctggatttgccgtt
ggagctggaatttcgaggcttggtggaggaggagcaccagcagctccagcctcttttgct
gaaataatggagcagagagggttgacgcagcaggatgctattgccgctttaaaaacctac
actcccggaggaaagtacgacgagttcataatgtttgcctctggaggacattctgggcag
gtgctcgtaatcggagttccgagcatgagattgtacaaagtaatagccgtattcacccca
gagccttggcagggatacggatatggactgaaggaaacccatgaagttcttaaaggaggg
tataacggaattcgcccattgagctggggagacactcatcatcctgaaatcagcagaacc
aatgctgagtttgacggagaatggctgtttattaacgataaagcaaacggcagagctgct
gttataagcctcaaggacttcgagacgaaacaaatagtaaaagttccgaacactcaaaca
gtccacggagggtgctttgccactccaaatactgaatacgttgcaattgtcagccaatat
gcaaccccatgggatcctgaaaaaggaggatacatccccggagaaacgtatgttgagttg
actgaggagaactacaagaagtacttcagaggaacttacacgtttttggctttcgacaga
aagaggggaagattcgacctatcaaagagcttccagatagagcttcctccgtacacgcag
gatcttgtagctgtaggatggggtccgagcgatggtttggctttctgcaactctttcaac
accgagttggctgttggaggtgtcttaaaaggaaaacctccacttgagattggaatgtcc
cagaacgatttcgactatcttcacgtaattctgtggaagaaggctgagcagtacgttaag
gaaggaggaggagaagtgataaacgggataagagtaataaggttgaaggaggctgttaag
gaggggctgatttactttgttcccgaaccaaaaagcccccacggatgtgatataacgccg
aacggagattacgtttgtgtcagtggaaagctcgatcccgttgtgacagtctatagcgtg
gagaagataaaaagggctatcgaagagaagaagttcgaaaagaaagatccctacggtgtt
ccagttttgaagtttgacgaagttgttgaggctcagatagaggttggtttaggtcctctc
cacacagaattcgacgataaaggctatgcttacacaagcctcttcatagacaacgctgta
gcaagatggaagcttggtccaccctacaacgaagatggatggaaagttgttgaaagaatt
cccataaactacaacgttggacatctggcaactccggagagtaactctccgacgccaaaa
ggaaagtatctcgtttccctaaacaagtggtcgatcgaaagattcccgcttgtcggtcca
ctgcatccgcagaacttccagttaattgacataagtggggagagaatgcagctcctttac
gacatgcccataggacttggtgaacctcactatgcgaagataatcagcatcgagaaactt
aagccactcgatgtttacccagctggaactgacccgcttaccttccagccacatccgaag
gcaatacagcagggacaggagagaattgagagaaagcaggagaacggaaagtgggttact
gagatttatgctacattaatcagaagtaccataactcctgacataatgaaagccaaagtg
ggagacatcgtgagaatttatctgacgaacgttgaatacacgagagatgcaacacatgga
ttctgtatcgcagagtacaacataaacgcgagtcttgagccgggagagactggaacgata
gagttcgttgcggacaagccaggagtttatgcgatctactgtacggagttctgttcacca
ctccacctggaaatggccggttggttagtaattgaaccataa

DBGET integrated database retrieval system