KEGG   Ferroglobus placidus: Ferp_0131Help
Entry
Ferp_0131         CDS       T01172                                 

Definition
periplasmic copper-binding protein
Orthology
K07218  
nitrous oxidase accessory protein
Organism
fpl  Ferroglobus placidus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
115178..116548
Genome map
AA seq 456 aa AA seqDB search
MLKITNILFLILIFLILIGVASGEIYYASPANITQVLEKARDGDTIYLLEGYYKGGIVLN
KSISLIGVNYPVIDAMGGVYGILIEANNCTVEKVKIINTSTSRSLQPAGIVLRSDYNIIR
NVVMENVYYGILPQEADYNIIEDCYLVGLRDVDINYRGDGIYLWNSRYNIIRNVTMLYFQ
DGIYSEHSYFNKLINNTVAYSRYAVHNMYCTDYLIDGMVSLQNIAGYVIMYSANVTVRNS
IAEVNWRSAVGEGIFVIETDNVLIENNTVYAGIYGMEIKRTPYRPGHYAIVRWNTIVYNQ
VGISVDEESSVIFYGNNFIENVDNIEAIGDIGRKMKWYSEELKVGNFWDTYAGFDKNKDG
IGDIPYVERSFAEHIIDSYPTLRIFMYTPAYQALETMSKIFPINPKISVYDPYPLMKPNV
NLNYKEKNVNAQMLFTSVLLVSASVIIIWRYGYGGY
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaattacaaatattttatttttaattttaatatttttaattctcattggagtt
gcttcgggagaaatctactacgcttcaccagccaatataactcaggtgcttgaaaaagct
cgtgatggagatacgatatatttgttggaaggttattataaaggaggaattgttctcaac
aagagtatttctctcatcggcgtaaactacccggttatagatgctatgggtggggtttac
gggatattaattgaggcaaacaactgcacggtggagaaggtaaaaataattaacacgtca
acatcgagaagtcttcagccggctggaatagtacttcgatcagattataatattataaga
aacgtagttatggagaacgtttactacggaattctgcctcaagaggctgattataatata
atagaagactgctacttggttggcttgagagatgtggacattaattataggggggacggt
atctacctctggaactccagatacaacataataaggaacgttacgatgctttacttccaa
gatggaatttacagcgaacattcgtacttcaacaagttgattaacaacaccgtcgcttat
tcacgctacgctgtccacaacatgtactgcacagattatttaatcgacggcatggtttct
ttgcaaaacatagctggttatgtgataatgtattcagcaaatgtcactgttagaaacagc
atagctgaggtaaattggaggagtgctgtcggagagggaatctttgtaattgaaactgac
aacgtcctaattgaaaacaacaccgtctatgctggtatatacggaatggagatcaagaga
acaccctacagaccggggcactatgctatagtaaggtggaacaccatagtctacaatcag
gtcggaatctcagtagatgaggaaagtagcgtgattttttacggaaacaatttcatagaa
aatgtggacaacatcgaggcgataggagatatagggagaaagatgaagtggtacagcgag
gagcttaaagtggggaatttctgggatacatatgctggattcgataaaaataaagacgga
attggagatattccctatgtggagaggagttttgccgaacatatcatcgacagctaccca
acccttagaatattcatgtacactcccgcatatcaggctttggagactatgtcaaagata
ttcccgataaatccgaaaattagtgtttacgatccttatcccttaatgaaaccgaatgtc
aatctgaactataaagagaaaaacgtgaatgctcaaatgttatttacttcagtccttctc
gtatcggcatctgtgataattatttggaggtatggttatggcggttattga

DBGET integrated database retrieval system