KEGG   Ferroglobus placidus: Ferp_0375Help
Entry
Ferp_0375         CDS       T01172                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fpl  Ferroglobus placidus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fpl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(324137..325171)
Genome map
AA seq 344 aa AA seqDB search
MFELIKKLSDAHGISGYEDEVREIVREELESYVDDVKVDKLGNIICVRKGDDFKVMLAAH
IDEIGFMVKHIDDKGFLRITPIGGWFSQTVLNQRVIVHGSKGKVYGVIGCKPPHLMKEDE
RKKVIEIKDMFVDVGAENKEEVKEMGIDIGSPVTIDREVVKLGKRITGKAFDNRAGLAVM
IEAMKKINTDATVYAVGTVQEEVGLKGARVSAFSLNPDVALVLDSAPATDFPGAESAYMD
VKLGRGPVITVADASGRGLIASKRVLEWLKDSAKKAEVEIQLEVGEGGTTDATAIHLTRE
GIPSGVVSVPARYIHTPVEVIDLRDVEQAVKLVAKAVEIAKEFF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaactaattaaaaagctgagcgacgctcacggaatttcgggctacgaagatgaa
gtgagggaaatcgttagggaggagttagaaagctacgtagacgatgtaaaggtggacaag
ctcggaaacattatctgcgttagaaaaggggacgattttaaagtgatgctcgctgcccac
atcgacgagatcgggttcatggtgaagcacatcgacgataaaggctttttgagaatcact
cccatcggcggttggttttcccagaccgtcttaaatcagagggtgatagtccacggaagc
aagggaaaggtttacggagtcatcggatgcaaaccgcctcacctgatgaaagaagacgag
aggaagaaggtgatcgagataaaagatatgttcgttgatgtgggtgctgagaataaggaa
gaagtcaaggagatgggaatagacatcggatctccggttacgatagacagagaggtcgtt
aagctcggaaaaagaattaccggaaaagcctttgacaacagagcgggattggcagttatg
atcgaggcgatgaaaaaaataaacaccgacgctaccgtttatgccgttggaaccgttcag
gaagaagtaggactaaaaggagcaagagtttccgctttttctttgaatccggacgttgcc
ttagtcctcgactccgctccagccacggattttcccggtgctgaaagcgcgtacatggat
gtgaaacttggaagaggaccggtaataacggtggctgatgcctctggaagagggttgatc
gcttcaaagagagttctggagtggttgaaagactctgctaagaaggctgaagtggaaatt
cagcttgaagtaggagaaggtggaacgaccgacgctaccgcaatacatctaacgagggaa
ggaattccttcgggagttgtcagcgttcccgcgaggtatatccacactccggtagaagtc
atcgacctgagagatgtcgaacaagctgttaagctcgttgccaaggctgtggaaatagct
aaagagttcttctaa

DBGET integrated database retrieval system