KEGG   Ferroglobus placidus: Ferp_0737Help
Entry
Ferp_0737         CDS       T01172                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fpl  Ferroglobus placidus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fpl01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:fpl00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:fpl00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
642230..643396
Genome map
AA seq 388 aa AA seqDB search
MYLLRCIECGSEFDSDFIYQCSKCNGLLDVVYDYSEIKLNFDGNNLSVWKYKDALPVKIK
PVSLREGGTPLYKIEKIESGVKNLFVKHEGLNPSGSFKDRGMTVGVTKAVELKMRTVICA
STGNTSASMAMYAAKAGLRAVVILPSGKVALGKLAQALMHGAKVIAVKDNFDKALEIVKS
LAMRKSLYLLNSINPFRLEGQKTIAYEIYDELGFVPDAIFVPVGNAGNISAIYKGFKELV
EMGYTDEVPRMIGVQAKGANPIYKAFVKGSREIEPVKNPETIATAIRIGAPVNAKKALRA
IYESKGAVIEVGDEEIVEAQKMLAAKEGIGVEPASAASLAGALKFEEELESAVCIATGNL
LKDPDEVIRVCGKPIEVEADVDVIEKLL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtatttgctgagatgcatagagtgcgggagcgaatttgattccgattttatctatcag
tgtagcaagtgcaacggattgcttgacgtcgtttacgattattcggaaattaagctgaat
tttgatggaaataatttgagcgtttggaagtacaaggatgctttgccggttaaaataaaa
ccggtttcccttagggaaggggggacacctctctacaaaatagagaaaatagagagcggt
gttaagaacctcttcgtcaaacacgaaggcttgaacccttctgggtcttttaaggataga
gggatgactgtaggagttaccaaagctgttgaactgaaaatgagaacagttatctgcgcc
tctactggcaacacttcggcttccatggctatgtatgctgctaaagccggtttgagagct
gtggtaatacttccttccggaaaagttgctctgggaaagcttgctcaggctttaatgcac
ggggctaaggttatagctgtaaaagacaacttcgacaaagctttggagatagtgaaaagc
ttggctatgagaaaatcactctaccttctgaactccataaatcccttcaggcttgagggg
caaaaaaccatagcttacgaaatttacgatgagctcggtttcgttcctgacgctattttc
gttccggtgggaaatgccgggaacatttccgctatctacaaaggttttaaggagcttgta
gagatgggatatactgatgaggtgccgagaatgataggagttcaggctaagggagctaat
cctatttacaaagcttttgtgaaaggaagcagggaaattgagccggttaaaaatccggaa
acaatcgctacggctataagaattggagctccagttaacgcgaaaaaggctttgagagcc
atttacgaatcgaaaggagctgtgattgaggttggcgacgaggaaatcgtcgaagctcag
aaaatgctcgcagctaaggaaggaataggagttgagccagcaagtgctgcaagcttggct
ggagcgttaaagttcgaagaggagcttgagagtgccgtctgcatagcaactggcaattta
cttaaagacccagacgaggtaatcagggtttgcggtaagccgattgaagtggaagcagat
gttgacgttatagaaaagcttctttaa

DBGET integrated database retrieval system