KEGG   Ferroglobus placidus: Ferp_0737Help
Entry
Ferp_0737         CDS       T01172                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fpl  Ferroglobus placidus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ferp_0737
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ferp_0737
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ferp_0737
Enzymes [BR:fpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ferp_0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
642230..643396
Genome map
AA seq 388 aa AA seqDB search
MYLLRCIECGSEFDSDFIYQCSKCNGLLDVVYDYSEIKLNFDGNNLSVWKYKDALPVKIK
PVSLREGGTPLYKIEKIESGVKNLFVKHEGLNPSGSFKDRGMTVGVTKAVELKMRTVICA
STGNTSASMAMYAAKAGLRAVVILPSGKVALGKLAQALMHGAKVIAVKDNFDKALEIVKS
LAMRKSLYLLNSINPFRLEGQKTIAYEIYDELGFVPDAIFVPVGNAGNISAIYKGFKELV
EMGYTDEVPRMIGVQAKGANPIYKAFVKGSREIEPVKNPETIATAIRIGAPVNAKKALRA
IYESKGAVIEVGDEEIVEAQKMLAAKEGIGVEPASAASLAGALKFEEELESAVCIATGNL
LKDPDEVIRVCGKPIEVEADVDVIEKLL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtatttgctgagatgcatagagtgcgggagcgaatttgattccgattttatctatcag
tgtagcaagtgcaacggattgcttgacgtcgtttacgattattcggaaattaagctgaat
tttgatggaaataatttgagcgtttggaagtacaaggatgctttgccggttaaaataaaa
ccggtttcccttagggaaggggggacacctctctacaaaatagagaaaatagagagcggt
gttaagaacctcttcgtcaaacacgaaggcttgaacccttctgggtcttttaaggataga
gggatgactgtaggagttaccaaagctgttgaactgaaaatgagaacagttatctgcgcc
tctactggcaacacttcggcttccatggctatgtatgctgctaaagccggtttgagagct
gtggtaatacttccttccggaaaagttgctctgggaaagcttgctcaggctttaatgcac
ggggctaaggttatagctgtaaaagacaacttcgacaaagctttggagatagtgaaaagc
ttggctatgagaaaatcactctaccttctgaactccataaatcccttcaggcttgagggg
caaaaaaccatagcttacgaaatttacgatgagctcggtttcgttcctgacgctattttc
gttccggtgggaaatgccgggaacatttccgctatctacaaaggttttaaggagcttgta
gagatgggatatactgatgaggtgccgagaatgataggagttcaggctaagggagctaat
cctatttacaaagcttttgtgaaaggaagcagggaaattgagccggttaaaaatccggaa
acaatcgctacggctataagaattggagctccagttaacgcgaaaaaggctttgagagcc
atttacgaatcgaaaggagctgtgattgaggttggcgacgaggaaatcgtcgaagctcag
aaaatgctcgcagctaaggaaggaataggagttgagccagcaagtgctgcaagcttggct
ggagcgttaaagttcgaagaggagcttgagagtgccgtctgcatagcaactggcaattta
cttaaagacccagacgaggtaatcagggtttgcggtaagccgattgaagtggaagcagat
gttgacgttatagaaaagcttctttaa

DBGET integrated database retrieval system