KEGG   Ferroglobus placidus: Ferp_0788Help
Entry
Ferp_0788         CDS       T01172                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fpl  Ferroglobus placidus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ferp_0788
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ferp_0788
   00620 Pyruvate metabolism
    Ferp_0788
   00640 Propanoate metabolism
    Ferp_0788
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ferp_0788
   00680 Methane metabolism
    Ferp_0788
Enzymes [BR:fpl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ferp_0788
Lipid biosynthesis proteins [BR:fpl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ferp_0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(696660..698564)
Genome map
AA seq 634 aa AA seqDB search
MKSIYPPEDFVEKANVKDPAIYSKAKENWIDYWESFAKELHWFEPWEKFFDDSKAPYYRF
FVNGKINASYNCVDRHLKEKRNKAAIIWEGEKGENRVLTYFDLYREVGKLSNALRNLGVK
KGDKVGIYMPNLPEAVISMLAAARIGATHVFIFAGFSPKSAAFRMKDSGVKLLITADGYY
RRGNLINLKEKADEALEEYKGVENVVVVRRAGNEIDMKEGRDHDYAELVRKEKAKSECEI
TDANDPLFIIYTSGSVAEPKGIIHSTGGYLVHVYATSKIVLDLKDEDVLFCTADLGWITG
HSYSVYGPLSLGATVLLYEGAPDYPDICRTFELIEKYGVTVFYTVPTLVRMLQGCGNIDS
FDLSTLRLIGSVGEPLEAENWLWLYEEVGKKKCPVVDTWWQTETGGIVIAPIPALTPMKP
GSVSKPLPGIEVDIYDSGGKKAKPYQLGHLVIKKMFPGFMLGIHGDPKAYVQLYWSKFGK
RVYLTGDYAYYDEDGYIWISGRADDVINISGHRVSLVEIEKVVKELREVADCAAIGVPDR
IKGTAIALFVVAEKSDDLAEKIKKKIEEDIGRIALPRLIVFVKELPKTAGKVFKRAIADA
VIKKEISGIASNVEVVKKIAEKIDKNASGVFFID
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcatataccctccggaagattttgtcgagaaagcgaacgttaaagatccggct
atctactcgaaagctaaggagaactggatagattactgggaaagctttgccaaagaattg
cactggtttgaaccttgggagaagtttttcgacgactcgaaggctccctactacagattt
ttcgtcaacggaaaaataaacgcaagctacaactgcgttgacaggcacttaaaagagaag
aggaacaaagctgctataatctgggagggggaaaagggggaaaacagagttctgacgtac
ttcgatttgtacagagaagtaggaaagctatccaacgctttgagaaatcttggtgtaaag
aagggagacaaagttggaatatacatgccgaatttaccggaagcggtaatctccatgctc
gctgccgcgagaataggggcaactcacgttttcatattcgcaggattttctccgaaatct
gcagctttcagaatgaaagattcaggagttaagcttctcataaccgctgacggatactac
agaaggggaaatttgataaacttaaaagagaaagccgacgaggctctcgaagagtacaaa
ggcgtagagaacgtcgtagtcgttaggagagcgggaaacgaaatcgatatgaaagaagga
agagatcacgactatgctgagctcgtaagaaaggagaaagctaagtcggaatgcgagata
acagatgctaacgatccgctcttcataatctacacttctgggagcgttgctgagcctaag
ggaattatccactccactggcggatacctcgttcacgtctacgcgacgagcaaaatagtt
ctcgacctgaaagatgaagacgttcttttctgcacagccgacctcggctggatcaccggg
cacagctactcggtttacggacctctttctttaggtgccacggttctcctctacgaagga
gctcctgactatccagacatatgcagaaccttcgagttgatagagaagtatggagttact
gtcttttacacagttccaactcttgtgagaatgcttcagggatgtgggaacatagatagc
ttcgacttatcgactctaaggttgataggtagcgtcggagagcccctcgaagctgaaaac
tggctctggctttacgaggaagtcgggaaaaagaaatgtcccgtagttgacacttggtgg
cagacggaaactggagggatagtcatcgctccaattccagccttaacacccatgaaaccc
ggctcagtttcgaaacccttgccggggatagaggtggacatatacgacagcggagggaaa
aaagccaagccctatcagctcggacatctggttataaagaaaatgttccccggattcatg
ctcggaattcacggagaccctaaagcctacgtgcagctttactggtctaagttcggtaag
agagtatacttaacgggagactacgcttactacgacgaagacgggtacatatggatctct
ggaagagctgacgacgttataaacataagcggtcacagagtttctctcgttgaaatagag
aaggtcgttaaggaactgagggaggtggctgattgcgccgctattggtgtgccggacaga
attaaaggaacagccatagcactcttcgtcgttgccgaaaaaagcgatgatttggctgag
aaaattaagaagaagatagaagaagatataggaaggatcgctcttccaagactcatcgtt
ttcgttaaggaacttccgaagacggctggcaaagtcttcaagagagctattgccgatgca
gtgataaagaaggagattagcgggatagcttcgaacgtggaagtcgtgaagaaaatagcg
gaaaaaatagataaaaacgcttcaggagttttcttcatcgactaa

DBGET integrated database retrieval system