KEGG   Ferroglobus placidus: Ferp_0811Help
Entry
Ferp_0811         CDS       T01172                                 

Definition
AMP phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
fpl  Ferroglobus placidus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ferp_0811
Enzymes [BR:fpl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Ferp_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(715602..717113)
Genome map
AA seq 503 aa AA seqDB search
MIFKVRLIPVKMNEFYGFANEEDLKEIGIIHGDRLKLVKGSKSITIFPQPSQIVARGEIG
IPINIAEELKVKDGEEIKAFPISRPKSVEYIRKKLSGKKLSKDEIYEIIEDIVNNSLSEI
ELTAFVVSNYLVGMDFDEIEWMTRAMIETGETISFEKGIVVDKHSIGGVPGNKISLIIVP
TVASAGLLIPKTASRAITSASGTADTMEVLANVNLSVEEIKEITERVGGVIAWGGATNIA
PADDKIIRVEYPLSLDPKPQLLASVMAKKGAVGAKHVVIDIPVGEGAKISDMKRGRELSS
DFVELGRRLGLNVTCAITYGGQPIGRAVGPALEAKEALKAMEERKGSSSLLEKSFGIAGI
LFEMAGIAMNGYEYAKELFMKGKTHEKFLEIVEAQGGEIRRSEEIMVGENTHTFTASFEG
AVVAVRNKAIVKIARAAGAPKDKGAGIVIHKKKGEVVKKGDPLFTIYAEKDWKLQNAVET
ARSDFPIIVSGMILDRYPSFKVM
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgatctttaaagtcagacttattccggtgaagatgaacgaattctacgggtttgccaat
gaagaagatttaaaggagattggaataattcacggagatagattaaagcttgtaaaggga
agcaagtccataacgatcttccctcagccttcgcagatagtagcgaggggagaaatcgga
attccgataaatattgctgaggagcttaaagttaaagatggtgaggaaatcaaagctttt
ccgatttcccgcccgaagagcgttgagtacataaggaaaaaactttctgggaaaaagtta
tcgaaggacgagatttacgaaataatcgaagacatcgtaaacaacagtttaagcgagata
gagcttacggctttcgtcgtctcgaattacctcgtagggatggacttcgacgagatcgaa
tggatgacgagagctatgatagaaactggggagacgataagcttcgagaaaggaatagtc
gtcgataagcacagcattggcggcgttcccggcaacaagatcagccttatcatagttccg
acggtagcttccgctggcttgctgattccaaaaaccgcaagcagagccataacttctgca
agcggcacggctgatacaatggaagttttagcgaacgtgaatctgagcgttgaggagata
aaggagataacggaaagagttggcggagtcatcgcttggggtggtgccactaacatagct
cctgctgacgataagataatcagggtggagtatcccctttcgctcgatcccaaaccacag
cttttagcaagcgttatggctaagaagggagccgtcggtgcaaagcatgttgtcatagac
attcccgtaggtgagggagcgaagatatccgacatgaagaggggaagagagctttcgagc
gattttgtcgagctgggaagaaggcttggactaaacgtgacttgcgcgataacatacggc
ggacagccaattggaagagctgtaggaccagctttagaggctaaggaagctttaaaagcc
atggaggagaggaaggggtcatcgagccttctcgaaaaatcctttggaatagccgggatt
ctcttcgaaatggctggaatagctatgaacggttacgagtacgctaaggaactcttcatg
aaaggcaaaactcacgagaagttcttggaaatcgttgaggctcagggaggggaaataagg
aggtcggaggagataatggtcggggaaaatacgcacacctttactgcctctttcgaaggg
gctgtggtggctgttaggaataaagcgatagtcaaaatagcgagagcagctggagctcca
aaagataagggtgctggaattgtcattcacaaaaagaagggagaggtcgtcaagaaagga
gatcctttatttacgatttacgctgagaaagactggaagcttcaaaatgcggtagaaacc
gcaagaagcgacttcccaattattgtttccggaatgatcctcgataggtatccttccttc
aaggtgatgtag

DBGET integrated database retrieval system